Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger MYM-type protein 5

Gene

ZMYM5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a transcriptional regulator.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri265 – 29935MYM-type 1Add
BLAST
Zinc fingeri311 – 35141MYM-type 2Add
BLAST
Zinc fingeri358 – 39336MYM-type 3Add
BLAST
Zinc fingeri404 – 43128MYM-type 4Add
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger MYM-type protein 5
Alternative name(s):
Zinc finger protein 198-like 1
Zinc finger protein 237
Gene namesi
Name:ZMYM5
Synonyms:ZNF198L1, ZNF237
ORF Names:HSPC050
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:13029. ZMYM5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi112 – 1121N → H: Abolishes interaction with ETV5. Abolished repression activity. 1 Publication
Mutagenesisi114 – 1141S → G: Abolishes interaction with ETV5. No effect on repression activity. 1 Publication
Mutagenesisi116 – 1161T → A: No effect on repression activity. 1 Publication
Mutagenesisi120 – 1201D → G: Increases repression activity. 1 Publication

Organism-specific databases

PharmGKBiPA37607.

Polymorphism and mutation databases

BioMutaiZMYM5.
DMDMi212288108.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 669669Zinc finger MYM-type protein 5PRO_0000191380Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki455 – 455Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiQ9UJ78.
MaxQBiQ9UJ78.
PaxDbiQ9UJ78.
PRIDEiQ9UJ78.

PTM databases

iPTMnetiQ9UJ78.
PhosphoSiteiQ9UJ78.

Expressioni

Gene expression databases

BgeeiQ9UJ78.
CleanExiHS_ZMYM5.
ExpressionAtlasiQ9UJ78. baseline and differential.
GenevisibleiQ9UJ78. HS.

Organism-specific databases

HPAiHPA020879.

Interactioni

Subunit structurei

Interacts (via N-terminal 120 amino acid region) with ETV5 (via C-terminal).1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SUMO1P631653EBI-7228860,EBI-80140

Protein-protein interaction databases

BioGridi114639. 7 interactions.
IntActiQ9UJ78. 4 interactions.
MINTiMINT-4714895.
STRINGi9606.ENSP00000372361.

Structurei

Secondary structure

1
669
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni245 – 2473Combined sources
Beta strandi266 – 2694Combined sources
Helixi270 – 2767Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DASNMR-A229-277[»]
ProteinModelPortaliQ9UJ78.
SMRiQ9UJ78. Positions 229-273.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UJ78.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi53 – 597Poly-Asp

Sequence similaritiesi

Contains 4 MYM-type zinc fingers.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri265 – 29935MYM-type 1Add
BLAST
Zinc fingeri311 – 35141MYM-type 2Add
BLAST
Zinc fingeri358 – 39336MYM-type 3Add
BLAST
Zinc fingeri404 – 43128MYM-type 4Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410JNGQ. Eukaryota.
ENOG41113IZ. LUCA.
GeneTreeiENSGT00550000074408.
HOVERGENiHBG108767.
InParanoidiQ9UJ78.
OMAiDPGTWPR.
PhylomeDBiQ9UJ78.

Family and domain databases

InterProiIPR011017. TRASH_dom.
IPR010507. Znf_MYM.
[Graphical view]
PfamiPF06467. zf-FCS. 3 hits.
[Graphical view]
SMARTiSM00746. TRASH. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 4 (identifier: Q9UJ78-4) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKCSVGGLE LTEQTPALLG NMAMATSLMD IGDSFGHPAC PLVSRSRNSP
60 70 80 90 100
VEDDDDDDDV VFIESIQPPS ISAPAIADQR NFIFASSKNE KPQGNYSVIP
110 120 130 140 150
PSSRDLASQK GNISETIVID DEEDIETNGG AEKKSSCFIE WGLPGTKNKT
160 170 180 190 200
NDLDFSTSSL SRSKTKTGVR PFNPGRMNVA GDLFQNGEFA THHSPDSWIS
210 220 230 240 250
QSASFPSNQK QPGVDSLSPV ALLRKQNFQP TAQQQLTKPA KITCANCKKP
260 270 280 290 300
LQKGQTAYQR KGSAHLFCST TCLSSFSHKR TQNTRSIICK KDASTKKANV
310 320 330 340 350
ILPVESSKSF QEFYSTSCLS PCENNWNLKK GVFNKSRCTI CSKLAEIRHE
360 370 380 390 400
VSVNNVTHKL CSNHCFNKYR LANGLIMNCC EHCGEYMPSK STGNNILVIG
410 420 430 440 450
GQQKRFCCQS CINEYKQMME TKSKKLTASE NRKRNAFREE NEKQLYGSSN
460 470 480 490 500
TLLKKIEGIP EKKEKTSQLQ LSVECGTDTL LIQENVNLPP SSTSTIADTF
510 520 530 540 550
QEQLEEKNFE DSIVPVVLSA DPGTWPRILN IKQRDTLVEN VPPQVRNFNF
560 570 580 590 600
PKDNTGRKFS ETYYTRILPN GEKTTRSWLL YSTSKDSVFC LYCKLFGEGK
610 620 630 640 650
NQLKNENGCK DWQHLSHILS KHEESEMHVN NSVKYSKLKS DLKKNKAIDA
660
AEHRLYENEK NDGVLLLYT
Note: No experimental confirmation available.
Length:669
Mass (Da):74,817
Last modified:July 22, 2008 - v4
Checksum:i3365CE4EFB8D73A9
GO
Isoform 1 (identifier: Q9UJ78-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-382: IRHEVSVNNVTHKLCSNHCFNKYRLANGLIMNCCEH → VWIFIPKLLFRLTVIILTFKCYYVLFHLHNARVLDV
     383-669: Missing.

Show »
Length:382
Mass (Da):42,107
Checksum:iCF8644A504028104
GO
Isoform 2 (identifier: Q9UJ78-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     196-208: DSWISQSASFPSN → EMHLQRRLMSFFQ
     209-669: Missing.

Show »
Length:208
Mass (Da):22,687
Checksum:i5387088CD2113459
GO
Isoform 3 (identifier: Q9UJ78-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-213: TKTGVRPFNP...SFPSNQKQPG → VNAGMGNSGI...NIIITYKTSL
     214-669: Missing.

Show »
Length:213
Mass (Da):22,729
Checksum:i2CC415998C9BB23E
GO
Isoform 5 (identifier: Q9UJ78-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-176: Missing.

Note: No experimental confirmation available.
Show »
Length:493
Mass (Da):55,907
Checksum:iC718F90BCFD74646
GO

Sequence cautioni

The sequence AAF29022.1 differs from that shown. Reason: Frameshift at positions 286, 322 and 337. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti210 – 2101K → R in AAF29022 (PubMed:11042152).Curated
Sequence conflicti214 – 2141V → M in AAF29022 (PubMed:11042152).Curated
Sequence conflicti286 – 2861S → A in AAF29022 (PubMed:11042152).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti125 – 1251I → V.2 Publications
Corresponds to variant rs9579718 [ dbSNP | Ensembl ].
VAR_025508
Natural varianti137 – 1371C → F.2 Publications
Corresponds to variant rs9579717 [ dbSNP | Ensembl ].
VAR_025509
Natural varianti231 – 2311T → A.
Corresponds to variant rs41292167 [ dbSNP | Ensembl ].
VAR_062160

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 176176Missing in isoform 5. CuratedVSP_034645Add
BLAST
Alternative sequencei165 – 21349TKTGV…QKQPG → VNAGMGNSGITTELTLKYII TNVTTLETGISSVNAGQDVN IIITYKTSL in isoform 3. 2 PublicationsVSP_011442Add
BLAST
Alternative sequencei196 – 20813DSWIS…SFPSN → EMHLQRRLMSFFQ in isoform 2. 3 PublicationsVSP_011443Add
BLAST
Alternative sequencei209 – 669461Missing in isoform 2. 3 PublicationsVSP_011444Add
BLAST
Alternative sequencei214 – 669456Missing in isoform 3. 2 PublicationsVSP_011445Add
BLAST
Alternative sequencei347 – 38236IRHEV…NCCEH → VWIFIPKLLFRLTVIILTFK CYYVLFHLHNARVLDV in isoform 1. 1 PublicationVSP_034646Add
BLAST
Alternative sequencei383 – 669287Missing in isoform 1. 1 PublicationVSP_034647Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133352 mRNA. Translation: CAB57262.1.
AJ133353 mRNA. Translation: CAB57263.1.
AJ133355 mRNA. Translation: CAB57265.1.
AJ133354 mRNA. Translation: CAB57264.1.
BT006687 mRNA. Translation: AAP35333.1.
AK312724 mRNA. Translation: BAG35598.1.
AL355001 Genomic DNA. Translation: CAI16180.1.
AL355001 Genomic DNA. Translation: CAI16181.1.
AL355001, AL354808 Genomic DNA. Translation: CAI16178.1.
AL354808, AL355001 Genomic DNA. Translation: CAI41001.1.
CH471075 Genomic DNA. Translation: EAX08238.1.
CH471075 Genomic DNA. Translation: EAX08240.1.
BC007048 mRNA. Translation: AAH07048.1.
AF161535 mRNA. Translation: AAF29022.1. Frameshift.
CCDSiCCDS31942.1. [Q9UJ78-1]
CCDS31943.1. [Q9UJ78-2]
RefSeqiNP_001034738.1. NM_001039649.2. [Q9UJ78-2]
NP_001034739.1. NM_001039650.2. [Q9UJ78-1]
NP_001136156.1. NM_001142684.1. [Q9UJ78-4]
XP_005266650.1. XM_005266593.3. [Q9UJ78-4]
XP_005266651.1. XM_005266594.2. [Q9UJ78-4]
XP_006719957.1. XM_006719894.2. [Q9UJ78-4]
UniGeneiHs.530988.

Genome annotation databases

EnsembliENST00000337963; ENSP00000337034; ENSG00000132950. [Q9UJ78-4]
ENST00000382905; ENSP00000372361; ENSG00000132950. [Q9UJ78-1]
ENST00000382907; ENSP00000372364; ENSG00000132950. [Q9UJ78-2]
GeneIDi9205.
KEGGihsa:9205.
UCSCiuc001umn.4. human. [Q9UJ78-4]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ133352 mRNA. Translation: CAB57262.1.
AJ133353 mRNA. Translation: CAB57263.1.
AJ133355 mRNA. Translation: CAB57265.1.
AJ133354 mRNA. Translation: CAB57264.1.
BT006687 mRNA. Translation: AAP35333.1.
AK312724 mRNA. Translation: BAG35598.1.
AL355001 Genomic DNA. Translation: CAI16180.1.
AL355001 Genomic DNA. Translation: CAI16181.1.
AL355001, AL354808 Genomic DNA. Translation: CAI16178.1.
AL354808, AL355001 Genomic DNA. Translation: CAI41001.1.
CH471075 Genomic DNA. Translation: EAX08238.1.
CH471075 Genomic DNA. Translation: EAX08240.1.
BC007048 mRNA. Translation: AAH07048.1.
AF161535 mRNA. Translation: AAF29022.1. Frameshift.
CCDSiCCDS31942.1. [Q9UJ78-1]
CCDS31943.1. [Q9UJ78-2]
RefSeqiNP_001034738.1. NM_001039649.2. [Q9UJ78-2]
NP_001034739.1. NM_001039650.2. [Q9UJ78-1]
NP_001136156.1. NM_001142684.1. [Q9UJ78-4]
XP_005266650.1. XM_005266593.3. [Q9UJ78-4]
XP_005266651.1. XM_005266594.2. [Q9UJ78-4]
XP_006719957.1. XM_006719894.2. [Q9UJ78-4]
UniGeneiHs.530988.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DASNMR-A229-277[»]
ProteinModelPortaliQ9UJ78.
SMRiQ9UJ78. Positions 229-273.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114639. 7 interactions.
IntActiQ9UJ78. 4 interactions.
MINTiMINT-4714895.
STRINGi9606.ENSP00000372361.

PTM databases

iPTMnetiQ9UJ78.
PhosphoSiteiQ9UJ78.

Polymorphism and mutation databases

BioMutaiZMYM5.
DMDMi212288108.

Proteomic databases

EPDiQ9UJ78.
MaxQBiQ9UJ78.
PaxDbiQ9UJ78.
PRIDEiQ9UJ78.

Protocols and materials databases

DNASUi9205.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000337963; ENSP00000337034; ENSG00000132950. [Q9UJ78-4]
ENST00000382905; ENSP00000372361; ENSG00000132950. [Q9UJ78-1]
ENST00000382907; ENSP00000372364; ENSG00000132950. [Q9UJ78-2]
GeneIDi9205.
KEGGihsa:9205.
UCSCiuc001umn.4. human. [Q9UJ78-4]

Organism-specific databases

CTDi9205.
GeneCardsiZMYM5.
HGNCiHGNC:13029. ZMYM5.
HPAiHPA020879.
MIMi616443. gene.
neXtProtiNX_Q9UJ78.
PharmGKBiPA37607.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JNGQ. Eukaryota.
ENOG41113IZ. LUCA.
GeneTreeiENSGT00550000074408.
HOVERGENiHBG108767.
InParanoidiQ9UJ78.
OMAiDPGTWPR.
PhylomeDBiQ9UJ78.

Miscellaneous databases

ChiTaRSiZMYM5. human.
EvolutionaryTraceiQ9UJ78.
GenomeRNAii9205.
PROiQ9UJ78.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UJ78.
CleanExiHS_ZMYM5.
ExpressionAtlasiQ9UJ78. baseline and differential.
GenevisibleiQ9UJ78. HS.

Family and domain databases

InterProiIPR011017. TRASH_dom.
IPR010507. Znf_MYM.
[Graphical view]
PfamiPF06467. zf-FCS. 3 hits.
[Graphical view]
SMARTiSM00746. TRASH. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of ZNF237, a novel member of the MYM gene family that maps to human chromosome 13q11-->q12."
    Sohal J., Reiter A., Goldman J.M., Cross N.C.
    Cytogenet. Cell Genet. 89:24-28(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
  2. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS VAL-125 AND PHE-137.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  4. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS VAL-125 AND PHE-137.
    Tissue: Urinary bladder.
  7. "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells."
    Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X.
    , Gu J., Chen S.-J., Chen Z.
    Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 165-346.
    Tissue: Umbilical cord blood.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Uncovering global SUMOylation signaling networks in a site-specific manner."
    Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M., Vertegaal A.C.
    Nat. Struct. Mol. Biol. 21:927-936(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-455, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Solution structure of TRASH domain of zinc finger MYM-type protein 5."
    RIKEN structural genomics initiative (RSGI)
    Submitted (JUN-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 229-277.
  11. "Analysis of transcriptional modulation of the presenilin 1 gene promoter by ZNF237, a candidate binding partner of the Ets transcription factor ERM."
    Pastorcic M., Das H.K.
    Brain Res. 1128:21-32(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ETV5, FUNCTION, MUTAGENESIS OF ASN-112; SER-114; THR-116 AND ASP-120.

Entry informationi

Entry nameiZMYM5_HUMAN
AccessioniPrimary (citable) accession number: Q9UJ78
Secondary accession number(s): B2R6V1
, Q5T6E1, Q5T6E2, Q5T6E4, Q96IY6, Q9NZY5, Q9UBW0, Q9UJ77
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: July 22, 2008
Last modified: June 8, 2016
This is version 113 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.