Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UJ68 (MSRA_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Mitochondrial peptide methionine sulfoxide reductase

EC=1.8.4.11
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name=Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name=PMSR
Gene names
Name:MSRA
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length235 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. HAMAP-Rule MF_01401

Catalytic activity

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin. HAMAP-Rule MF_01401

L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin. HAMAP-Rule MF_01401

Subcellular location

Isoform 1: Mitochondrion Ref.2 Ref.3 Ref.10.

Isoform 2: Cytoplasm.

Isoform 3: Cytoplasm. Nucleus Ref.2 Ref.3 Ref.10.

Isoform 5: Cytoplasm. Membrane; Lipid-anchor Ref.2 Ref.3 Ref.10.

Tissue specificity

Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.

Sequence similarities

Belongs to the MsrA Met sulfoxide reductase family.

Alternative products

This entry describes 5 isoforms produced by alternative promoter usage, alternative splicing and alternative initiation. [Align] [Select]

Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon.
Isoform 1 (identifier: Q9UJ68-1)

Also known as: MsrA1; mitoMSRA; a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Mitochondrial. Produced by alternative splicing.
Isoform 2 (identifier: Q9UJ68-2)

Also known as: MsrA2; d;

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.
Note: Cytoplasmic. Produced by alternative promoter usage.
Isoform 3 (identifier: Q9UJ68-3)

Also known as: MsrA3; cytoMSRA; c;

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAA → MCSEP
Note: Cytoplasmic and nuclear. Produced by alternative promoter usage.
Isoform 4 (identifier: Q9UJ68-4)

Also known as: b;

The sequence of this isoform differs from the canonical sequence as follows:
     71-110: Missing.
Note: Produced by alternative splicing.
Isoform 5 (identifier: Q9UJ68-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.
Note: Cytoplasmic. Contains a N-myristoyl glycine at position 2. Produced by alternative initiation.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 2323Mitochondrion HAMAP-Rule MF_01401
Chain24 – 235212Mitochondrial peptide methionine sulfoxide reductase HAMAP-Rule MF_01401
PRO_0000138626

Amino acid modifications

Modified residue1061N6-acetyllysine; alternate By similarity
Modified residue1061N6-succinyllysine; alternate By similarity

Natural variations

Alternative sequence1 – 6666Missing in isoform 2.
VSP_041405
Alternative sequence1 – 4848MLSAT…TPVAA → MCSEP in isoform 3.
VSP_041406
Alternative sequence1 – 2222Missing in isoform 5.
VSP_042132
Alternative sequence71 – 11040Missing in isoform 4.
VSP_041407

Experimental info

Mutagenesis61R → A: Impaired subcellular location. Ref.10
Mutagenesis71R → A: Impaired subcellular location. Ref.10
Mutagenesis11 – 133Missing: Impaired subcellular location.
Mutagenesis221R → A: Impaired subcellular location. Ref.10
Sequence conflict12 – 143Missing in AAG09689. Ref.6
Sequence conflict134 – 1374LKVF → SRL in AAG09689. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (MsrA1) (mitoMSRA) (a) [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: B89A9BBBE4D58D90

FASTA23526,132
        10         20         30         40         50         60 
MLSATRRACQ LLLLHSLFPV PRMGNSASNI VSPQEALPGR KEQTPVAAKH HVNGNRTVEP 

        70         80         90        100        110        120 
FPEGTQMAVF GMGCFWGAER KFWVLKGVYS TQVGFAGGYT SNPTYKEVCS EKTGHAEVVR 

       130        140        150        160        170        180 
VVYQPEHMSF EELLKVFWEN HDPTQGMRQG NDHGTQYRSA IYPTSAKQME AALSSKENYQ 

       190        200        210        220        230 
KVLSEHGFGP ITTDIREGQT FYYAEDYHQQ YLSKNPNGYC GLGGTGVSCP VGIKK 

« Hide

Isoform 2 (MsrA2) (d) [UniParc].

Checksum: 4741F1AF6ECA34DC
Show »

FASTA16918,963
Isoform 3 (MsrA3) (cytoMSRA) (c) [UniParc].

Checksum: 0B919D21F23A79A6
Show »

FASTA19221,540
Isoform 4 (b) [UniParc].

Checksum: ECDCC13F2C46BA89
Show »

FASTA19521,737
Isoform 5 [UniParc].

Checksum: A25E9F9AB29DA412
Show »

FASTA21323,627

References

« Hide 'large scale' references
[1]"Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA)."
Kuschel L., Hansel A., Schoenherr R., Weissbach H., Brot N., Hoshi T., Heinemann S.H.
FEBS Lett. 456:17-21(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Lung.
[2]"Heterogeneity and function of mammalian MSRs: enzymes for repair, protection and regulation."
Hansel A., Heinemann S.H., Hoshi T.
Biochim. Biophys. Acta 1703:239-247(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
[3]"Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina."
Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R.
Exp. Eye Res. 82:816-827(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE PROMOTER USAGE, SUBCELLULAR LOCATION.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Cerebellum.
[5]"Cloning of a novel human cDNA which shows great homology to Bos taurus methionine sulfoxide reductase (msrA) mRNA."
Zhao Y., Yu L., Tu Q., Yue P., Zhang M., Zhao S.Y.
Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
[6]"A novel gene expressed in human hypothalamus."
Peng Y., Huang C., Gu Y., Xu S., Han Z., Fu G., Chen Z.
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hypothalamus.
[7]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Uterus.
[10]"Mitochondrial targeting of the human peptide methionine sulfoxide reductase (MSRA), an enzyme involved in the repair of oxidized proteins."
Hansel A., Kuschel L., Hehl S., Lemke C., Agricola H.J., Hoshi T., Heinemann S.H.
FASEB J. 16:911-913(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-6; ARG-7; ARG-22 AND 11-LEU--LEU-14.
[11]"Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A."
Kim G., Cole N.B., Lim J.C., Zhao H., Levine R.L.
J. Biol. Chem. 285:18085-18094(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: MYRISTOYLATION (ISOFORM 5), ALTERNATIVE INITIATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ242973 mRNA. Translation: CAB59628.1.
AY690665 mRNA. Translation: AAU11088.1.
AY958429 mRNA. Translation: AAY17426.1.
AY958430 mRNA. Translation: AAY17427.1.
AY958431 mRNA. Translation: AAY17428.1.
AY958432 Genomic DNA. Translation: AAY17429.1.
AY958432 Genomic DNA. Translation: AAY17430.1.
AY958432 Genomic DNA. Translation: AAY17431.1.
AK293488 mRNA. Translation: BAH11521.1.
AF086925 mRNA. Translation: AAP97154.1.
AF183420 mRNA. Translation: AAG09689.1.
AC023385 Genomic DNA. No translation available.
AC034111 Genomic DNA. No translation available.
AC079200 Genomic DNA. No translation available.
AC112673 Genomic DNA. No translation available.
CH471157 Genomic DNA. Translation: EAW65584.1.
CH471157 Genomic DNA. Translation: EAW65585.1.
BC054033 mRNA. Translation: AAH54033.1.
RefSeqNP_001129142.1. NM_001135670.1.
NP_001129143.1. NM_001135671.1.
NP_001186658.1. NM_001199729.1.
NP_036463.1. NM_012331.3.
UniGeneHs.490981.

3D structure databases

ProteinModelPortalQ9UJ68.
SMRQ9UJ68. Positions 30-230.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid110588. 2 interactions.
STRING9606.ENSP00000313921.

Chemistry

DrugBankDB00134. L-Methionine.

PTM databases

PhosphoSiteQ9UJ68.

Polymorphism databases

DMDM12230350.

Proteomic databases

PaxDbQ9UJ68.
PRIDEQ9UJ68.

Protocols and materials databases

DNASU4482.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000317173; ENSP00000313921; ENSG00000175806. [Q9UJ68-1]
ENST00000382490; ENSP00000371930; ENSG00000175806. [Q9UJ68-3]
ENST00000441698; ENSP00000410912; ENSG00000175806. [Q9UJ68-4]
ENST00000528246; ENSP00000436839; ENSG00000175806. [Q9UJ68-2]
GeneID4482.
KEGGhsa:4482.
UCSCuc003wsx.3. human. [Q9UJ68-1]
uc003wsz.3. human. [Q9UJ68-3]
uc011kwx.2. human. [Q9UJ68-4]

Organism-specific databases

CTD4482.
GeneCardsGC08P009949.
H-InvDBHIX0168875.
HGNCHGNC:7377. MSRA.
HPAHPA023804.
MIM601250. gene.
neXtProtNX_Q9UJ68.
PharmGKBPA31182.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0225.
HOGENOMHOG000263862.
HOVERGENHBG006401.
InParanoidQ9UJ68.
KOK07304.
OMAGEWWDAE.
OrthoDBEOG76X610.
PhylomeDBQ9UJ68.
TreeFamTF353884.

Gene expression databases

ArrayExpressQ9UJ68.
BgeeQ9UJ68.
CleanExHS_MSRA.
GenevestigatorQ9UJ68.

Family and domain databases

Gene3D3.30.1060.10. 1 hit.
HAMAPMF_01401. MsrA.
InterProIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERPTHR10173. PTHR10173. 1 hit.
PfamPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMSSF55068. SSF55068. 1 hit.
TIGRFAMsTIGR00401. msrA. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMSRA. human.
GeneWikiMSRA_(gene).
GenomeRNAi4482.
NextBio17345.
PROQ9UJ68.
SOURCESearch...

Entry information

Entry nameMSRA_HUMAN
AccessionPrimary (citable) accession number: Q9UJ68
Secondary accession number(s): E9PAS8 expand/collapse secondary AC list , Q52TC4, Q549N4, Q66MI7
Entry history
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: March 19, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM