Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

MSRA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

GO - Molecular functioni

GO - Biological processi

  • cellular protein modification process Source: ProtInc
  • methionine metabolic process Source: ProtInc
  • protein repair Source: Reactome
  • response to oxidative stress Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Enzyme and pathway databases

BioCyciZFISH:HS10977-MONOMER.
BRENDAi1.8.4.11. 2681.
ReactomeiR-HSA-5676934. Protein repair.

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
Gene namesi
Name:MSRA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:7377. MSRA.

Subcellular locationi

GO - Cellular componenti

  • actin cytoskeleton Source: HPA
  • cytoplasm Source: HPA
  • cytosol Source: Reactome
  • extracellular exosome Source: UniProtKB
  • membrane Source: UniProtKB-SubCell
  • mitochondrion Source: UniProtKB-SubCell
  • nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi6R → A: Impaired subcellular location. 1 Publication1
Mutagenesisi7R → A: Impaired subcellular location. 1 Publication1
Mutagenesisi11 – 13Missing : Impaired subcellular location. 3
Mutagenesisi22R → A: Impaired subcellular location. 1 Publication1

Organism-specific databases

DisGeNETi4482.
OpenTargetsiENSG00000175806.
PharmGKBiPA31182.

Chemistry databases

DrugBankiDB00134. L-Methionine.

Polymorphism and mutation databases

BioMutaiMSRA.
DMDMi12230350.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 23MitochondrionAdd BLAST23
ChainiPRO_000013862624 – 235Mitochondrial peptide methionine sulfoxide reductaseAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei106N6-acetyllysine; alternateBy similarity1
Modified residuei106N6-succinyllysine; alternateBy similarity1
Isoform 5 (identifier: Q9UJ68-5)
Lipidationi2N-myristoyl glycine2 Publications1

Keywords - PTMi

Acetylation, Lipoprotein, Myristate

Proteomic databases

EPDiQ9UJ68.
PaxDbiQ9UJ68.
PeptideAtlasiQ9UJ68.
PRIDEiQ9UJ68.

PTM databases

iPTMnetiQ9UJ68.
PhosphoSitePlusiQ9UJ68.

Expressioni

Tissue specificityi

Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.

Gene expression databases

BgeeiENSG00000175806.
CleanExiHS_MSRA.
ExpressionAtlasiQ9UJ68. baseline and differential.
GenevisibleiQ9UJ68. HS.

Organism-specific databases

HPAiHPA023804.
HPA053069.

Interactioni

Protein-protein interaction databases

BioGridi110588. 4 interactors.
STRINGi9606.ENSP00000313921.

Structurei

3D structure databases

ProteinModelPortaliQ9UJ68.
SMRiQ9UJ68.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1635. Eukaryota.
COG0225. LUCA.
GeneTreeiENSGT00390000003823.
HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ9UJ68.
KOiK07304.
OMAiMVLRSEI.
OrthoDBiEOG091G0MD8.
PhylomeDBiQ9UJ68.
TreeFamiTF353884.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA. 1 hit.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. AlignAdd to basket

Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon.
Isoform 1 (identifier: Q9UJ68-1) [UniParc]FASTAAdd to basket
Also known as: MsrA1, mitoMSRA, a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSATRRACQ LLLLHSLFPV PRMGNSASNI VSPQEALPGR KEQTPVAAKH
60 70 80 90 100
HVNGNRTVEP FPEGTQMAVF GMGCFWGAER KFWVLKGVYS TQVGFAGGYT
110 120 130 140 150
SNPTYKEVCS EKTGHAEVVR VVYQPEHMSF EELLKVFWEN HDPTQGMRQG
160 170 180 190 200
NDHGTQYRSA IYPTSAKQME AALSSKENYQ KVLSEHGFGP ITTDIREGQT
210 220 230
FYYAEDYHQQ YLSKNPNGYC GLGGTGVSCP VGIKK
Note: Mitochondrial. Produced by alternative splicing.
Length:235
Mass (Da):26,132
Last modified:May 1, 2000 - v1
Checksum:iB89A9BBBE4D58D90
GO
Isoform 2 (identifier: Q9UJ68-2) [UniParc]FASTAAdd to basket
Also known as: MsrA2, d

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Note: Cytoplasmic. Produced by alternative promoter usage.
Show »
Length:169
Mass (Da):18,963
Checksum:i4741F1AF6ECA34DC
GO
Isoform 3 (identifier: Q9UJ68-3) [UniParc]FASTAAdd to basket
Also known as: MsrA3, cytoMSRA, c

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAA → MCSEP

Note: Cytoplasmic and nuclear. Produced by alternative promoter usage.
Show »
Length:192
Mass (Da):21,540
Checksum:i0B919D21F23A79A6
GO
Isoform 4 (identifier: Q9UJ68-4) [UniParc]FASTAAdd to basket
Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     71-110: Missing.

Note: Produced by alternative splicing.
Show »
Length:195
Mass (Da):21,737
Checksum:iECDCC13F2C46BA89
GO
Isoform 5 (identifier: Q9UJ68-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.

Note: Cytoplasmic.2 Publications Produced by alternative initiation.2 Publications
Show »
Length:213
Mass (Da):23,627
Checksum:iA25E9F9AB29DA412
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12 – 14Missing in AAG09689 (Ref. 6) Curated3
Sequence conflicti134 – 137LKVF → SRL in AAG09689 (Ref. 6) Curated4

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414051 – 66Missing in isoform 2. 2 PublicationsAdd BLAST66
Alternative sequenceiVSP_0414061 – 48MLSAT…TPVAA → MCSEP in isoform 3. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_0421321 – 22Missing in isoform 5. CuratedAdd BLAST22
Alternative sequenceiVSP_04140771 – 110Missing in isoform 4. CuratedAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242973 mRNA. Translation: CAB59628.1.
AY690665 mRNA. Translation: AAU11088.1.
AY958429 mRNA. Translation: AAY17426.1.
AY958430 mRNA. Translation: AAY17427.1.
AY958431 mRNA. Translation: AAY17428.1.
AY958432 Genomic DNA. Translation: AAY17429.1.
AY958432 Genomic DNA. Translation: AAY17430.1.
AY958432 Genomic DNA. Translation: AAY17431.1.
AK293488 mRNA. Translation: BAH11521.1.
AF086925 mRNA. Translation: AAP97154.1.
AF183420 mRNA. Translation: AAG09689.1.
AC023385 Genomic DNA. No translation available.
AC034111 Genomic DNA. No translation available.
AC079200 Genomic DNA. No translation available.
AC112673 Genomic DNA. No translation available.
CH471157 Genomic DNA. Translation: EAW65584.1.
CH471157 Genomic DNA. Translation: EAW65585.1.
BC054033 mRNA. Translation: AAH54033.1.
CCDSiCCDS47798.1. [Q9UJ68-4]
CCDS47799.1. [Q9UJ68-3]
CCDS56522.1. [Q9UJ68-2]
CCDS5975.1. [Q9UJ68-1]
RefSeqiNP_001129142.1. NM_001135670.2. [Q9UJ68-4]
NP_001129143.1. NM_001135671.2. [Q9UJ68-3]
NP_001186658.1. NM_001199729.2. [Q9UJ68-2]
NP_036463.1. NM_012331.4. [Q9UJ68-1]
XP_016868938.1. XM_017013449.1. [Q9UJ68-2]
XP_016868939.1. XM_017013450.1. [Q9UJ68-2]
UniGeneiHs.490981.

Genome annotation databases

EnsembliENST00000317173; ENSP00000313921; ENSG00000175806. [Q9UJ68-1]
ENST00000382490; ENSP00000371930; ENSG00000175806. [Q9UJ68-3]
ENST00000441698; ENSP00000410912; ENSG00000175806. [Q9UJ68-4]
ENST00000528246; ENSP00000436839; ENSG00000175806. [Q9UJ68-2]
GeneIDi4482.
KEGGihsa:4482.
UCSCiuc003wsx.4. human. [Q9UJ68-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242973 mRNA. Translation: CAB59628.1.
AY690665 mRNA. Translation: AAU11088.1.
AY958429 mRNA. Translation: AAY17426.1.
AY958430 mRNA. Translation: AAY17427.1.
AY958431 mRNA. Translation: AAY17428.1.
AY958432 Genomic DNA. Translation: AAY17429.1.
AY958432 Genomic DNA. Translation: AAY17430.1.
AY958432 Genomic DNA. Translation: AAY17431.1.
AK293488 mRNA. Translation: BAH11521.1.
AF086925 mRNA. Translation: AAP97154.1.
AF183420 mRNA. Translation: AAG09689.1.
AC023385 Genomic DNA. No translation available.
AC034111 Genomic DNA. No translation available.
AC079200 Genomic DNA. No translation available.
AC112673 Genomic DNA. No translation available.
CH471157 Genomic DNA. Translation: EAW65584.1.
CH471157 Genomic DNA. Translation: EAW65585.1.
BC054033 mRNA. Translation: AAH54033.1.
CCDSiCCDS47798.1. [Q9UJ68-4]
CCDS47799.1. [Q9UJ68-3]
CCDS56522.1. [Q9UJ68-2]
CCDS5975.1. [Q9UJ68-1]
RefSeqiNP_001129142.1. NM_001135670.2. [Q9UJ68-4]
NP_001129143.1. NM_001135671.2. [Q9UJ68-3]
NP_001186658.1. NM_001199729.2. [Q9UJ68-2]
NP_036463.1. NM_012331.4. [Q9UJ68-1]
XP_016868938.1. XM_017013449.1. [Q9UJ68-2]
XP_016868939.1. XM_017013450.1. [Q9UJ68-2]
UniGeneiHs.490981.

3D structure databases

ProteinModelPortaliQ9UJ68.
SMRiQ9UJ68.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110588. 4 interactors.
STRINGi9606.ENSP00000313921.

Chemistry databases

DrugBankiDB00134. L-Methionine.

PTM databases

iPTMnetiQ9UJ68.
PhosphoSitePlusiQ9UJ68.

Polymorphism and mutation databases

BioMutaiMSRA.
DMDMi12230350.

Proteomic databases

EPDiQ9UJ68.
PaxDbiQ9UJ68.
PeptideAtlasiQ9UJ68.
PRIDEiQ9UJ68.

Protocols and materials databases

DNASUi4482.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317173; ENSP00000313921; ENSG00000175806. [Q9UJ68-1]
ENST00000382490; ENSP00000371930; ENSG00000175806. [Q9UJ68-3]
ENST00000441698; ENSP00000410912; ENSG00000175806. [Q9UJ68-4]
ENST00000528246; ENSP00000436839; ENSG00000175806. [Q9UJ68-2]
GeneIDi4482.
KEGGihsa:4482.
UCSCiuc003wsx.4. human. [Q9UJ68-1]

Organism-specific databases

CTDi4482.
DisGeNETi4482.
GeneCardsiMSRA.
H-InvDBHIX0168875.
HGNCiHGNC:7377. MSRA.
HPAiHPA023804.
HPA053069.
MIMi601250. gene.
neXtProtiNX_Q9UJ68.
OpenTargetsiENSG00000175806.
PharmGKBiPA31182.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1635. Eukaryota.
COG0225. LUCA.
GeneTreeiENSGT00390000003823.
HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ9UJ68.
KOiK07304.
OMAiMVLRSEI.
OrthoDBiEOG091G0MD8.
PhylomeDBiQ9UJ68.
TreeFamiTF353884.

Enzyme and pathway databases

BioCyciZFISH:HS10977-MONOMER.
BRENDAi1.8.4.11. 2681.
ReactomeiR-HSA-5676934. Protein repair.

Miscellaneous databases

ChiTaRSiMSRA. human.
GeneWikiiMSRA_(gene).
GenomeRNAii4482.
PROiQ9UJ68.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000175806.
CleanExiHS_MSRA.
ExpressionAtlasiQ9UJ68. baseline and differential.
GenevisibleiQ9UJ68. HS.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA. 1 hit.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMSRA_HUMAN
AccessioniPrimary (citable) accession number: Q9UJ68
Secondary accession number(s): E9PAS8
, Q52TC4, Q549N4, Q66MI7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.