Q9UJ68 (MSRA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mitochondrial peptide methionine sulfoxide reductase EC=1.8.4.11 Alternative name(s): Peptide-methionine (S)-S-oxide reductase Short name=Peptide Met(O) reductase Protein-methionine-S-oxide reductase Short name=PMSR | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 235 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine. |
| Catalytic activity | Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin. L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin. |
| Subcellular location | Isoform 1: Mitochondrion Ref.2 Ref.3 Ref.10. Isoform 2: Cytoplasm Ref.2 Ref.3 Ref.10. Isoform 3: Cytoplasm. Nucleus Ref.2 Ref.3 Ref.10. Isoform 5: Cytoplasm. Membrane; Lipid-anchor Ref.2 Ref.3 Ref.10. |
| Tissue specificity | Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus. |
| Sequence similarities | Belongs to the MsrA Met sulfoxide reductase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane Mitochondrion Nucleus |
| Coding sequence diversity | Alternative initiation Alternative promoter usage Alternative splicing |
| Domain | Transit peptide |
| Molecular function | Oxidoreductase |
| PTM | Lipoprotein Myristate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | methionine metabolic process Traceable author statement. Source: ProtInc protein modification processTraceable author statement. Source: ProtInc response to oxidative stressTraceable author statement. Source: ProtInc |
| Cellular component | mitochondrion Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | peptide-methionine-(S)-S-oxide reductase activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage, alternative splicing and alternative initiation. [Align] [Select] Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon. | ||||||
| Isoform 1 (identifier: Q9UJ68-1) Also known as: MsrA1; mitoMSRA; a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Mitochondrial. Produced by alternative splicing. | ||||||
| Isoform 2 (identifier: Q9UJ68-2) Also known as: MsrA2; d; The sequence of this isoform differs from the canonical sequence as follows: 1-66: Missing. | ||||||
| Note: Cytoplasmic. Produced by alternative promoter usage. | ||||||
| Isoform 3 (identifier: Q9UJ68-3) Also known as: MsrA3; cytoMSRA; c; The sequence of this isoform differs from the canonical sequence as follows: 1-48: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAA → MCSEP | ||||||
| Note: Cytoplasmic and nuclear. Produced by alternative promoter usage. | ||||||
| Isoform 4 (identifier: Q9UJ68-4) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 71-110: Missing. | ||||||
| Note: Produced by alternative splicing. | ||||||
| Isoform 5 (identifier: Q9UJ68-5) The sequence of this isoform differs from the canonical sequence as follows: 1-22: Missing. | ||||||
| Note: Cytoplasmic. Myristoylated at Gly-2. Produced by alternative initiation. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 23 | 23 | Mitochondrion | ||||||
| Chain | 24 – 235 | 212 | Mitochondrial peptide methionine sulfoxide reductase | PRO_0000138626 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 66 | 66 | Missing in isoform 2. | VSP_041405 | |||||
| Alternative sequence | 1 – 48 | 48 | MLSAT…TPVAA → MCSEP in isoform 3. | VSP_041406 | |||||
| Alternative sequence | 1 – 22 | 22 | Missing in isoform 5. | VSP_042132 | |||||
| Alternative sequence | 71 – 110 | 40 | Missing in isoform 4. | VSP_041407 | |||||
Experimental info | |||||||||
| Mutagenesis | 6 | 1 | R → A: Impaired subcellular location. Ref.10 | ||||||
| Mutagenesis | 7 | 1 | R → A: Impaired subcellular location. Ref.10 | ||||||
| Mutagenesis | 11 – 13 | 3 | Missing: Impaired subcellular location. | ||||||
| Mutagenesis | 22 | 1 | R → A: Impaired subcellular location. Ref.10 | ||||||
| Sequence conflict | 12 – 14 | 3 | Missing in AAG09689. Ref.6 | ||||||
| Sequence conflict | 134 – 137 | 4 | LKVF → SRL in AAG09689. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA)." Kuschel L., Hansel A., Schoenherr R., Weissbach H., Brot N., Hoshi T., Heinemann S.H. FEBS Lett. 456:17-21(1999) [PubMed: 10452521] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lung. |
| [2] | "Heterogeneity and function of mammalian MSRs: enzymes for repair, protection and regulation." Hansel A., Heinemann S.H., Hoshi T. Biochim. Biophys. Acta 1703:239-247(2005) [PubMed: 15680232] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION. |
| [3] | "Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina." Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R. Exp. Eye Res. 82:816-827(2006) [PubMed: 16364291] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE PROMOTER USAGE, SUBCELLULAR LOCATION. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cerebellum. |
| [5] | "Clonging of a novel human cDNA which shows great homology to Bos taurus methionine sulfoxide reductase (msrA) mRNA." Zhao Y., Yu L., Tu Q., Yue P., Zhang M., Zhao S.Y. Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [6] | "A novel gene expressed in human hypothalamus." Peng Y., Huang C., Gu Y., Xu S., Han Z., Fu G., Chen Z. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hypothalamus. |
| [7] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed: 16421571] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [10] | "Mitochondrial targeting of the human peptide methionine sulfoxide reductase (MSRA), an enzyme involved in the repair of oxidized proteins." Hansel A., Kuschel L., Hehl S., Lemke C., Agricola H.J., Hoshi T., Heinemann S.H. FASEB J. 16:911-913(2002) [PubMed: 12039877] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-6; ARG-7; ARG-22 AND 11-LEU--LEU-14. |
| [11] | "Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A." Kim G., Cole N.B., Lim J.C., Zhao H., Levine R.L. J. Biol. Chem. 285:18085-18094(2010) [PubMed: 20368336] [Abstract] Cited for: MYRISTOYLATION (ISOFORM 5), ALTERNATIVE INITIATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ242973 mRNA. Translation: CAB59628.1. AY690665 mRNA. Translation: AAU11088.1. AY958429 mRNA. Translation: AAY17426.1. AY958430 mRNA. Translation: AAY17427.1. AY958431 mRNA. Translation: AAY17428.1. AY958432 Genomic DNA. Translation: AAY17429.1. AY958432 Genomic DNA. Translation: AAY17430.1. AY958432 Genomic DNA. Translation: AAY17431.1. AK293488 mRNA. Translation: BAH11521.1. AF086925 mRNA. Translation: AAP97154.1. AF183420 mRNA. Translation: AAG09689.1. AC023385 Genomic DNA. No translation available. AC034111 Genomic DNA. No translation available. AC079200 Genomic DNA. No translation available. AC112673 Genomic DNA. No translation available. CH471157 Genomic DNA. Translation: EAW65584.1. CH471157 Genomic DNA. Translation: EAW65585.1. BC054033 mRNA. Translation: AAH54033.1. |
| IPI | IPI00006592. IPI00794951. IPI00796388. IPI01016029. |
| RefSeq | NP_001129142.1. NM_001135670.1. NP_001129143.1. NM_001135671.1. NP_001186658.1. NM_001199729.1. NP_036463.1. NM_012331.3. |
| UniGene | Hs.490981. |
3D structure databases | |
| ProteinModelPortal | Q9UJ68. |
| SMR | Q9UJ68. Positions 30-230. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9UJ68. |
PTM databases | |
| PhosphoSite | Q9UJ68. |
Polymorphism databases | |
| DMDM | 12230350. |
Proteomic databases | |
| PRIDE | Q9UJ68. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000317173; ENSP00000313921; ENSG00000175806. ENST00000382490; ENSP00000371930; ENSG00000175806. ENST00000425987; ENSP00000405901; ENSG00000175806. ENST00000441698; ENSP00000410912; ENSG00000175806. ENST00000527408; ENSP00000435971; ENSG00000175806. ENST00000528246; ENSP00000436839; ENSG00000175806. |
| GeneID | 4482. |
| KEGG | hsa:4482. |
| UCSC | uc003wsx.1. human. |
Organism-specific databases | |
| CTD | 4482. |
| GeneCards | GC08P009949. |
| H-InvDB | HIX0017874. |
| HGNC | HGNC:7377. MSRA. |
| HPA | HPA023804. |
| MIM | 601250. gene. |
| neXtProt | NX_Q9UJ68. |
| PharmGKB | PA31182. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000003823. |
| HOGENOM | HBG748152. |
| HOVERGEN | HBG006401. |
| InParanoid | Q9UJ68. |
| OMA | SAIYCTT. |
| OrthoDB | EOG4H19WS. |
| PhylomeDB | Q9UJ68. |
Gene expression databases | |
| ArrayExpress | Q9UJ68. |
| Bgee | Q9UJ68. |
| CleanEx | HS_MSRA. |
| Genevestigator | Q9UJ68. |
| GermOnline | ENSG00000175806. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002569. Peptide_Met_Sox_Rdtase_MsrA. [Graphical view] |
| Gene3D | G3DSA:3.30.1060.10. MsrA. 1 hit. |
| KO | K07304. |
| Pfam | PF01625. PMSR. 1 hit. [Graphical view] |
| SUPFAM | SSF55068. MsrA. 1 hit. |
| TIGRFAMs | TIGR00401. MsrA. 1 hit. |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00134. L-Methionine. |
| NextBio | 17345. |
| SOURCE | Search... |
Entry information
| Entry name | MSRA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UJ68 Secondary accession number(s): E9PAS8 Q66MI7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with