Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UJ68

- MSRA_HUMAN

UniProt

Q9UJ68 - MSRA_HUMAN

Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

MSRA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

    Catalytic activityi

    Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
    L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

    GO - Molecular functioni

    1. peptide-methionine (S)-S-oxide reductase activity Source: ProtInc

    GO - Biological processi

    1. cellular protein modification process Source: ProtInc
    2. methionine metabolic process Source: ProtInc
    3. protein repair Source: InterPro
    4. response to oxidative stress Source: ProtInc

    Keywords - Molecular functioni

    Oxidoreductase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
    Alternative name(s):
    Peptide-methionine (S)-S-oxide reductase
    Short name:
    Peptide Met(O) reductase
    Protein-methionine-S-oxide reductase
    Short name:
    PMSR
    Gene namesi
    Name:MSRA
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:7377. MSRA.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. membrane Source: UniProtKB-SubCell
    3. mitochondrion Source: UniProtKB-SubCell
    4. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Mitochondrion, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi6 – 61R → A: Impaired subcellular location. 1 Publication
    Mutagenesisi7 – 71R → A: Impaired subcellular location. 1 Publication
    Mutagenesisi11 – 133Missing: Impaired subcellular location.
    Mutagenesisi22 – 221R → A: Impaired subcellular location. 1 Publication

    Organism-specific databases

    PharmGKBiPA31182.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 2323MitochondrionAdd
    BLAST
    Chaini24 – 235212Mitochondrial peptide methionine sulfoxide reductasePRO_0000138626Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei106 – 1061N6-acetyllysine; alternateBy similarity
    Modified residuei106 – 1061N6-succinyllysine; alternateBy similarity

    Keywords - PTMi

    Acetylation, Lipoprotein, Myristate

    Proteomic databases

    MaxQBiQ9UJ68.
    PaxDbiQ9UJ68.
    PRIDEiQ9UJ68.

    PTM databases

    PhosphoSiteiQ9UJ68.

    Expressioni

    Tissue specificityi

    Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.

    Gene expression databases

    ArrayExpressiQ9UJ68.
    BgeeiQ9UJ68.
    CleanExiHS_MSRA.
    GenevestigatoriQ9UJ68.

    Organism-specific databases

    HPAiHPA023804.

    Interactioni

    Protein-protein interaction databases

    BioGridi110588. 2 interactions.
    STRINGi9606.ENSP00000313921.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UJ68.
    SMRiQ9UJ68. Positions 30-230.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0225.
    HOGENOMiHOG000263862.
    HOVERGENiHBG006401.
    InParanoidiQ9UJ68.
    KOiK07304.
    OMAiYRCHAAT.
    OrthoDBiEOG76X610.
    PhylomeDBiQ9UJ68.
    TreeFamiTF353884.

    Family and domain databases

    Gene3Di3.30.1060.10. 1 hit.
    HAMAPiMF_01401. MsrA.
    InterProiIPR028427. Met_Sox_Rdtase.
    IPR002569. Met_Sox_Rdtase_MsrA.
    [Graphical view]
    PANTHERiPTHR10173. PTHR10173. 1 hit.
    PfamiPF01625. PMSR. 1 hit.
    [Graphical view]
    SUPFAMiSSF55068. SSF55068. 1 hit.
    TIGRFAMsiTIGR00401. msrA. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. Align

    Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon.

    Isoform 1 (identifier: Q9UJ68-1) [UniParc]FASTAAdd to Basket

    Also known as: MsrA1, mitoMSRA, a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLSATRRACQ LLLLHSLFPV PRMGNSASNI VSPQEALPGR KEQTPVAAKH    50
    HVNGNRTVEP FPEGTQMAVF GMGCFWGAER KFWVLKGVYS TQVGFAGGYT 100
    SNPTYKEVCS EKTGHAEVVR VVYQPEHMSF EELLKVFWEN HDPTQGMRQG 150
    NDHGTQYRSA IYPTSAKQME AALSSKENYQ KVLSEHGFGP ITTDIREGQT 200
    FYYAEDYHQQ YLSKNPNGYC GLGGTGVSCP VGIKK 235

    Note: Mitochondrial. Produced by alternative splicing.

    Length:235
    Mass (Da):26,132
    Last modified:May 1, 2000 - v1
    Checksum:iB89A9BBBE4D58D90
    GO
    Isoform 2 (identifier: Q9UJ68-2) [UniParc]FASTAAdd to Basket

    Also known as: MsrA2, d

    The sequence of this isoform differs from the canonical sequence as follows:
         1-66: Missing.

    Note: Cytoplasmic. Produced by alternative promoter usage.

    Show »
    Length:169
    Mass (Da):18,963
    Checksum:i4741F1AF6ECA34DC
    GO
    Isoform 3 (identifier: Q9UJ68-3) [UniParc]FASTAAdd to Basket

    Also known as: MsrA3, cytoMSRA, c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-48: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAA → MCSEP

    Note: Cytoplasmic and nuclear. Produced by alternative promoter usage.

    Show »
    Length:192
    Mass (Da):21,540
    Checksum:i0B919D21F23A79A6
    GO
    Isoform 4 (identifier: Q9UJ68-4) [UniParc]FASTAAdd to Basket

    Also known as: b

    The sequence of this isoform differs from the canonical sequence as follows:
         71-110: Missing.

    Note: Produced by alternative splicing.

    Show »
    Length:195
    Mass (Da):21,737
    Checksum:iECDCC13F2C46BA89
    GO
    Isoform 5 (identifier: Q9UJ68-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: Missing.

    Note: Cytoplasmic. Contains a N-myristoyl glycine at position 2. Produced by alternative initiation.

    Show »
    Length:213
    Mass (Da):23,627
    Checksum:iA25E9F9AB29DA412
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti12 – 143Missing in AAG09689. 1 PublicationCurated
    Sequence conflicti134 – 1374LKVF → SRL in AAG09689. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6666Missing in isoform 2. 2 PublicationsVSP_041405Add
    BLAST
    Alternative sequencei1 – 4848MLSAT…TPVAA → MCSEP in isoform 3. 2 PublicationsVSP_041406Add
    BLAST
    Alternative sequencei1 – 2222Missing in isoform 5. CuratedVSP_042132Add
    BLAST
    Alternative sequencei71 – 11040Missing in isoform 4. CuratedVSP_041407Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ242973 mRNA. Translation: CAB59628.1.
    AY690665 mRNA. Translation: AAU11088.1.
    AY958429 mRNA. Translation: AAY17426.1.
    AY958430 mRNA. Translation: AAY17427.1.
    AY958431 mRNA. Translation: AAY17428.1.
    AY958432 Genomic DNA. Translation: AAY17429.1.
    AY958432 Genomic DNA. Translation: AAY17430.1.
    AY958432 Genomic DNA. Translation: AAY17431.1.
    AK293488 mRNA. Translation: BAH11521.1.
    AF086925 mRNA. Translation: AAP97154.1.
    AF183420 mRNA. Translation: AAG09689.1.
    AC023385 Genomic DNA. No translation available.
    AC034111 Genomic DNA. No translation available.
    AC079200 Genomic DNA. No translation available.
    AC112673 Genomic DNA. No translation available.
    CH471157 Genomic DNA. Translation: EAW65584.1.
    CH471157 Genomic DNA. Translation: EAW65585.1.
    BC054033 mRNA. Translation: AAH54033.1.
    CCDSiCCDS47798.1. [Q9UJ68-4]
    CCDS47799.1. [Q9UJ68-3]
    CCDS56522.1. [Q9UJ68-2]
    CCDS5975.1. [Q9UJ68-1]
    RefSeqiNP_001129142.1. NM_001135670.2. [Q9UJ68-4]
    NP_001129143.1. NM_001135671.2. [Q9UJ68-3]
    NP_001186658.1. NM_001199729.2. [Q9UJ68-2]
    NP_036463.1. NM_012331.4. [Q9UJ68-1]
    UniGeneiHs.490981.

    Genome annotation databases

    EnsembliENST00000317173; ENSP00000313921; ENSG00000175806. [Q9UJ68-1]
    ENST00000382490; ENSP00000371930; ENSG00000175806. [Q9UJ68-3]
    ENST00000441698; ENSP00000410912; ENSG00000175806. [Q9UJ68-4]
    ENST00000528246; ENSP00000436839; ENSG00000175806. [Q9UJ68-2]
    GeneIDi4482.
    KEGGihsa:4482.
    UCSCiuc003wsx.3. human. [Q9UJ68-1]
    uc003wsz.3. human. [Q9UJ68-3]
    uc011kwx.2. human. [Q9UJ68-4]

    Polymorphism databases

    DMDMi12230350.

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ242973 mRNA. Translation: CAB59628.1 .
    AY690665 mRNA. Translation: AAU11088.1 .
    AY958429 mRNA. Translation: AAY17426.1 .
    AY958430 mRNA. Translation: AAY17427.1 .
    AY958431 mRNA. Translation: AAY17428.1 .
    AY958432 Genomic DNA. Translation: AAY17429.1 .
    AY958432 Genomic DNA. Translation: AAY17430.1 .
    AY958432 Genomic DNA. Translation: AAY17431.1 .
    AK293488 mRNA. Translation: BAH11521.1 .
    AF086925 mRNA. Translation: AAP97154.1 .
    AF183420 mRNA. Translation: AAG09689.1 .
    AC023385 Genomic DNA. No translation available.
    AC034111 Genomic DNA. No translation available.
    AC079200 Genomic DNA. No translation available.
    AC112673 Genomic DNA. No translation available.
    CH471157 Genomic DNA. Translation: EAW65584.1 .
    CH471157 Genomic DNA. Translation: EAW65585.1 .
    BC054033 mRNA. Translation: AAH54033.1 .
    CCDSi CCDS47798.1. [Q9UJ68-4 ]
    CCDS47799.1. [Q9UJ68-3 ]
    CCDS56522.1. [Q9UJ68-2 ]
    CCDS5975.1. [Q9UJ68-1 ]
    RefSeqi NP_001129142.1. NM_001135670.2. [Q9UJ68-4 ]
    NP_001129143.1. NM_001135671.2. [Q9UJ68-3 ]
    NP_001186658.1. NM_001199729.2. [Q9UJ68-2 ]
    NP_036463.1. NM_012331.4. [Q9UJ68-1 ]
    UniGenei Hs.490981.

    3D structure databases

    ProteinModelPortali Q9UJ68.
    SMRi Q9UJ68. Positions 30-230.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 110588. 2 interactions.
    STRINGi 9606.ENSP00000313921.

    Chemistry

    DrugBanki DB00134. L-Methionine.

    PTM databases

    PhosphoSitei Q9UJ68.

    Polymorphism databases

    DMDMi 12230350.

    Proteomic databases

    MaxQBi Q9UJ68.
    PaxDbi Q9UJ68.
    PRIDEi Q9UJ68.

    Protocols and materials databases

    DNASUi 4482.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317173 ; ENSP00000313921 ; ENSG00000175806 . [Q9UJ68-1 ]
    ENST00000382490 ; ENSP00000371930 ; ENSG00000175806 . [Q9UJ68-3 ]
    ENST00000441698 ; ENSP00000410912 ; ENSG00000175806 . [Q9UJ68-4 ]
    ENST00000528246 ; ENSP00000436839 ; ENSG00000175806 . [Q9UJ68-2 ]
    GeneIDi 4482.
    KEGGi hsa:4482.
    UCSCi uc003wsx.3. human. [Q9UJ68-1 ]
    uc003wsz.3. human. [Q9UJ68-3 ]
    uc011kwx.2. human. [Q9UJ68-4 ]

    Organism-specific databases

    CTDi 4482.
    GeneCardsi GC08P009949.
    H-InvDB HIX0168875.
    HGNCi HGNC:7377. MSRA.
    HPAi HPA023804.
    MIMi 601250. gene.
    neXtProti NX_Q9UJ68.
    PharmGKBi PA31182.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0225.
    HOGENOMi HOG000263862.
    HOVERGENi HBG006401.
    InParanoidi Q9UJ68.
    KOi K07304.
    OMAi YRCHAAT.
    OrthoDBi EOG76X610.
    PhylomeDBi Q9UJ68.
    TreeFami TF353884.

    Miscellaneous databases

    ChiTaRSi MSRA. human.
    GeneWikii MSRA_(gene).
    GenomeRNAii 4482.
    NextBioi 17345.
    PROi Q9UJ68.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UJ68.
    Bgeei Q9UJ68.
    CleanExi HS_MSRA.
    Genevestigatori Q9UJ68.

    Family and domain databases

    Gene3Di 3.30.1060.10. 1 hit.
    HAMAPi MF_01401. MsrA.
    InterProi IPR028427. Met_Sox_Rdtase.
    IPR002569. Met_Sox_Rdtase_MsrA.
    [Graphical view ]
    PANTHERi PTHR10173. PTHR10173. 1 hit.
    Pfami PF01625. PMSR. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55068. SSF55068. 1 hit.
    TIGRFAMsi TIGR00401. msrA. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA)."
      Kuschel L., Hansel A., Schoenherr R., Weissbach H., Brot N., Hoshi T., Heinemann S.H.
      FEBS Lett. 456:17-21(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Lung.
    2. "Heterogeneity and function of mammalian MSRs: enzymes for repair, protection and regulation."
      Hansel A., Heinemann S.H., Hoshi T.
      Biochim. Biophys. Acta 1703:239-247(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
    3. "Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina."
      Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R.
      Exp. Eye Res. 82:816-827(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE PROMOTER USAGE, SUBCELLULAR LOCATION.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Cerebellum.
    5. "Cloning of a novel human cDNA which shows great homology to Bos taurus methionine sulfoxide reductase (msrA) mRNA."
      Zhao Y., Yu L., Tu Q., Yue P., Zhang M., Zhao S.Y.
      Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    6. "A novel gene expressed in human hypothalamus."
      Peng Y., Huang C., Gu Y., Xu S., Han Z., Fu G., Chen Z.
      Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hypothalamus.
    7. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Uterus.
    10. "Mitochondrial targeting of the human peptide methionine sulfoxide reductase (MSRA), an enzyme involved in the repair of oxidized proteins."
      Hansel A., Kuschel L., Hehl S., Lemke C., Agricola H.J., Hoshi T., Heinemann S.H.
      FASEB J. 16:911-913(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-6; ARG-7; ARG-22 AND 11-LEU--LEU-14.
    11. "Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A."
      Kim G., Cole N.B., Lim J.C., Zhao H., Levine R.L.
      J. Biol. Chem. 285:18085-18094(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: MYRISTOYLATION (ISOFORM 5), ALTERNATIVE INITIATION.

    Entry informationi

    Entry nameiMSRA_HUMAN
    AccessioniPrimary (citable) accession number: Q9UJ68
    Secondary accession number(s): E9PAS8
    , Q52TC4, Q549N4, Q66MI7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 117 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3