Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UJ68

- MSRA_HUMAN

UniProt

Q9UJ68 - MSRA_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Mitochondrial peptide methionine sulfoxide reductase

Gene

MSRA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Catalytic activityi

Peptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxin.
L-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin.

GO - Molecular functioni

  1. peptide-methionine (S)-S-oxide reductase activity Source: ProtInc

GO - Biological processi

  1. cellular protein modification process Source: ProtInc
  2. methionine metabolic process Source: ProtInc
  3. protein repair Source: InterPro
  4. response to oxidative stress Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Names & Taxonomyi

Protein namesi
Recommended name:
Mitochondrial peptide methionine sulfoxide reductase (EC:1.8.4.11)
Alternative name(s):
Peptide-methionine (S)-S-oxide reductase
Short name:
Peptide Met(O) reductase
Protein-methionine-S-oxide reductase
Short name:
PMSR
Gene namesi
Name:MSRA
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:7377. MSRA.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. membrane Source: UniProtKB-KW
  3. mitochondrion Source: UniProtKB-KW
  4. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi6 – 61R → A: Impaired subcellular location. 1 Publication
Mutagenesisi7 – 71R → A: Impaired subcellular location. 1 Publication
Mutagenesisi11 – 133Missing: Impaired subcellular location.
Mutagenesisi22 – 221R → A: Impaired subcellular location. 1 Publication

Organism-specific databases

PharmGKBiPA31182.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 2323MitochondrionAdd
BLAST
Chaini24 – 235212Mitochondrial peptide methionine sulfoxide reductasePRO_0000138626Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei106 – 1061N6-acetyllysine; alternateBy similarity
Modified residuei106 – 1061N6-succinyllysine; alternateBy similarity

Keywords - PTMi

Acetylation, Lipoprotein, Myristate

Proteomic databases

MaxQBiQ9UJ68.
PaxDbiQ9UJ68.
PRIDEiQ9UJ68.

PTM databases

PhosphoSiteiQ9UJ68.

Expressioni

Tissue specificityi

Ubiquitous. Highest expression in adult kidney and cerebellum, followed by liver, heart ventricles, bone marrow and hippocampus.

Gene expression databases

BgeeiQ9UJ68.
CleanExiHS_MSRA.
ExpressionAtlasiQ9UJ68. baseline and differential.
GenevestigatoriQ9UJ68.

Organism-specific databases

HPAiHPA023804.

Interactioni

Protein-protein interaction databases

BioGridi110588. 2 interactions.
STRINGi9606.ENSP00000313921.

Structurei

3D structure databases

ProteinModelPortaliQ9UJ68.
SMRiQ9UJ68. Positions 30-230.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiCOG0225.
GeneTreeiENSGT00390000003823.
HOGENOMiHOG000263862.
HOVERGENiHBG006401.
InParanoidiQ9UJ68.
KOiK07304.
OMAiYRCHAAT.
OrthoDBiEOG76X610.
PhylomeDBiQ9UJ68.
TreeFamiTF353884.

Family and domain databases

Gene3Di3.30.1060.10. 1 hit.
HAMAPiMF_01401. MsrA.
InterProiIPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view]
PANTHERiPTHR10173. PTHR10173. 1 hit.
PfamiPF01625. PMSR. 1 hit.
[Graphical view]
SUPFAMiSSF55068. SSF55068. 1 hit.
TIGRFAMsiTIGR00401. msrA. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. Align

Note: Only about 25% of mRNAs are initiated at the mitochondrial isoform 1 codon.

Isoform 1 (identifier: Q9UJ68-1) [UniParc]FASTAAdd to Basket

Also known as: MsrA1, mitoMSRA, a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSATRRACQ LLLLHSLFPV PRMGNSASNI VSPQEALPGR KEQTPVAAKH
60 70 80 90 100
HVNGNRTVEP FPEGTQMAVF GMGCFWGAER KFWVLKGVYS TQVGFAGGYT
110 120 130 140 150
SNPTYKEVCS EKTGHAEVVR VVYQPEHMSF EELLKVFWEN HDPTQGMRQG
160 170 180 190 200
NDHGTQYRSA IYPTSAKQME AALSSKENYQ KVLSEHGFGP ITTDIREGQT
210 220 230
FYYAEDYHQQ YLSKNPNGYC GLGGTGVSCP VGIKK

Note: Mitochondrial. Produced by alternative splicing.

Length:235
Mass (Da):26,132
Last modified:May 1, 2000 - v1
Checksum:iB89A9BBBE4D58D90
GO
Isoform 2 (identifier: Q9UJ68-2) [UniParc]FASTAAdd to Basket

Also known as: MsrA2, d

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: Missing.

Note: Cytoplasmic. Produced by alternative promoter usage.

Show »
Length:169
Mass (Da):18,963
Checksum:i4741F1AF6ECA34DC
GO
Isoform 3 (identifier: Q9UJ68-3) [UniParc]FASTAAdd to Basket

Also known as: MsrA3, cytoMSRA, c

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAA → MCSEP

Note: Cytoplasmic and nuclear. Produced by alternative promoter usage.

Show »
Length:192
Mass (Da):21,540
Checksum:i0B919D21F23A79A6
GO
Isoform 4 (identifier: Q9UJ68-4) [UniParc]FASTAAdd to Basket

Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     71-110: Missing.

Note: Produced by alternative splicing.

Show »
Length:195
Mass (Da):21,737
Checksum:iECDCC13F2C46BA89
GO
Isoform 5 (identifier: Q9UJ68-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.

Note: Cytoplasmic. Contains a N-myristoyl glycine at position 2. Produced by alternative initiation.

Show »
Length:213
Mass (Da):23,627
Checksum:iA25E9F9AB29DA412
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti12 – 143Missing in AAG09689. 1 PublicationCurated
Sequence conflicti134 – 1374LKVF → SRL in AAG09689. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6666Missing in isoform 2. 2 PublicationsVSP_041405Add
BLAST
Alternative sequencei1 – 4848MLSAT…TPVAA → MCSEP in isoform 3. 2 PublicationsVSP_041406Add
BLAST
Alternative sequencei1 – 2222Missing in isoform 5. CuratedVSP_042132Add
BLAST
Alternative sequencei71 – 11040Missing in isoform 4. CuratedVSP_041407Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242973 mRNA. Translation: CAB59628.1.
AY690665 mRNA. Translation: AAU11088.1.
AY958429 mRNA. Translation: AAY17426.1.
AY958430 mRNA. Translation: AAY17427.1.
AY958431 mRNA. Translation: AAY17428.1.
AY958432 Genomic DNA. Translation: AAY17429.1.
AY958432 Genomic DNA. Translation: AAY17430.1.
AY958432 Genomic DNA. Translation: AAY17431.1.
AK293488 mRNA. Translation: BAH11521.1.
AF086925 mRNA. Translation: AAP97154.1.
AF183420 mRNA. Translation: AAG09689.1.
AC023385 Genomic DNA. No translation available.
AC034111 Genomic DNA. No translation available.
AC079200 Genomic DNA. No translation available.
AC112673 Genomic DNA. No translation available.
CH471157 Genomic DNA. Translation: EAW65584.1.
CH471157 Genomic DNA. Translation: EAW65585.1.
BC054033 mRNA. Translation: AAH54033.1.
CCDSiCCDS47798.1. [Q9UJ68-4]
CCDS47799.1. [Q9UJ68-3]
CCDS56522.1. [Q9UJ68-2]
CCDS5975.1. [Q9UJ68-1]
RefSeqiNP_001129142.1. NM_001135670.2. [Q9UJ68-4]
NP_001129143.1. NM_001135671.2. [Q9UJ68-3]
NP_001186658.1. NM_001199729.2. [Q9UJ68-2]
NP_036463.1. NM_012331.4. [Q9UJ68-1]
UniGeneiHs.490981.

Genome annotation databases

EnsembliENST00000317173; ENSP00000313921; ENSG00000175806. [Q9UJ68-1]
ENST00000382490; ENSP00000371930; ENSG00000175806. [Q9UJ68-3]
ENST00000441698; ENSP00000410912; ENSG00000175806. [Q9UJ68-4]
ENST00000528246; ENSP00000436839; ENSG00000175806. [Q9UJ68-2]
GeneIDi4482.
KEGGihsa:4482.
UCSCiuc003wsx.3. human. [Q9UJ68-1]
uc003wsz.3. human. [Q9UJ68-3]
uc011kwx.2. human. [Q9UJ68-4]

Polymorphism databases

DMDMi12230350.

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242973 mRNA. Translation: CAB59628.1 .
AY690665 mRNA. Translation: AAU11088.1 .
AY958429 mRNA. Translation: AAY17426.1 .
AY958430 mRNA. Translation: AAY17427.1 .
AY958431 mRNA. Translation: AAY17428.1 .
AY958432 Genomic DNA. Translation: AAY17429.1 .
AY958432 Genomic DNA. Translation: AAY17430.1 .
AY958432 Genomic DNA. Translation: AAY17431.1 .
AK293488 mRNA. Translation: BAH11521.1 .
AF086925 mRNA. Translation: AAP97154.1 .
AF183420 mRNA. Translation: AAG09689.1 .
AC023385 Genomic DNA. No translation available.
AC034111 Genomic DNA. No translation available.
AC079200 Genomic DNA. No translation available.
AC112673 Genomic DNA. No translation available.
CH471157 Genomic DNA. Translation: EAW65584.1 .
CH471157 Genomic DNA. Translation: EAW65585.1 .
BC054033 mRNA. Translation: AAH54033.1 .
CCDSi CCDS47798.1. [Q9UJ68-4 ]
CCDS47799.1. [Q9UJ68-3 ]
CCDS56522.1. [Q9UJ68-2 ]
CCDS5975.1. [Q9UJ68-1 ]
RefSeqi NP_001129142.1. NM_001135670.2. [Q9UJ68-4 ]
NP_001129143.1. NM_001135671.2. [Q9UJ68-3 ]
NP_001186658.1. NM_001199729.2. [Q9UJ68-2 ]
NP_036463.1. NM_012331.4. [Q9UJ68-1 ]
UniGenei Hs.490981.

3D structure databases

ProteinModelPortali Q9UJ68.
SMRi Q9UJ68. Positions 30-230.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 110588. 2 interactions.
STRINGi 9606.ENSP00000313921.

Chemistry

DrugBanki DB00134. L-Methionine.

PTM databases

PhosphoSitei Q9UJ68.

Polymorphism databases

DMDMi 12230350.

Proteomic databases

MaxQBi Q9UJ68.
PaxDbi Q9UJ68.
PRIDEi Q9UJ68.

Protocols and materials databases

DNASUi 4482.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317173 ; ENSP00000313921 ; ENSG00000175806 . [Q9UJ68-1 ]
ENST00000382490 ; ENSP00000371930 ; ENSG00000175806 . [Q9UJ68-3 ]
ENST00000441698 ; ENSP00000410912 ; ENSG00000175806 . [Q9UJ68-4 ]
ENST00000528246 ; ENSP00000436839 ; ENSG00000175806 . [Q9UJ68-2 ]
GeneIDi 4482.
KEGGi hsa:4482.
UCSCi uc003wsx.3. human. [Q9UJ68-1 ]
uc003wsz.3. human. [Q9UJ68-3 ]
uc011kwx.2. human. [Q9UJ68-4 ]

Organism-specific databases

CTDi 4482.
GeneCardsi GC08P009949.
H-InvDB HIX0168875.
HGNCi HGNC:7377. MSRA.
HPAi HPA023804.
MIMi 601250. gene.
neXtProti NX_Q9UJ68.
PharmGKBi PA31182.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0225.
GeneTreei ENSGT00390000003823.
HOGENOMi HOG000263862.
HOVERGENi HBG006401.
InParanoidi Q9UJ68.
KOi K07304.
OMAi YRCHAAT.
OrthoDBi EOG76X610.
PhylomeDBi Q9UJ68.
TreeFami TF353884.

Miscellaneous databases

ChiTaRSi MSRA. human.
GeneWikii MSRA_(gene).
GenomeRNAii 4482.
NextBioi 17345.
PROi Q9UJ68.
SOURCEi Search...

Gene expression databases

Bgeei Q9UJ68.
CleanExi HS_MSRA.
ExpressionAtlasi Q9UJ68. baseline and differential.
Genevestigatori Q9UJ68.

Family and domain databases

Gene3Di 3.30.1060.10. 1 hit.
HAMAPi MF_01401. MsrA.
InterProi IPR028427. Met_Sox_Rdtase.
IPR002569. Met_Sox_Rdtase_MsrA.
[Graphical view ]
PANTHERi PTHR10173. PTHR10173. 1 hit.
Pfami PF01625. PMSR. 1 hit.
[Graphical view ]
SUPFAMi SSF55068. SSF55068. 1 hit.
TIGRFAMsi TIGR00401. msrA. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and functional expression of a human peptide methionine sulfoxide reductase (hMsrA)."
    Kuschel L., Hansel A., Schoenherr R., Weissbach H., Brot N., Hoshi T., Heinemann S.H.
    FEBS Lett. 456:17-21(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Lung.
  2. "Heterogeneity and function of mammalian MSRs: enzymes for repair, protection and regulation."
    Hansel A., Heinemann S.H., Hoshi T.
    Biochim. Biophys. Acta 1703:239-247(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
  3. "Gene structure, localization and role in oxidative stress of methionine sulfoxide reductase A (MSRA) in the monkey retina."
    Lee J.W., Gordiyenko N.V., Marchetti M., Tserentsoodol N., Sagher D., Alam S., Weissbach H., Kantorow M., Rodriguez I.R.
    Exp. Eye Res. 82:816-827(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE PROMOTER USAGE, SUBCELLULAR LOCATION.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Cerebellum.
  5. "Cloning of a novel human cDNA which shows great homology to Bos taurus methionine sulfoxide reductase (msrA) mRNA."
    Zhao Y., Yu L., Tu Q., Yue P., Zhang M., Zhao S.Y.
    Submitted (AUG-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  6. "A novel gene expressed in human hypothalamus."
    Peng Y., Huang C., Gu Y., Xu S., Han Z., Fu G., Chen Z.
    Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hypothalamus.
  7. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  10. "Mitochondrial targeting of the human peptide methionine sulfoxide reductase (MSRA), an enzyme involved in the repair of oxidized proteins."
    Hansel A., Kuschel L., Hehl S., Lemke C., Agricola H.J., Hoshi T., Heinemann S.H.
    FASEB J. 16:911-913(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF ARG-6; ARG-7; ARG-22 AND 11-LEU--LEU-14.
  11. "Dual sites of protein initiation control the localization and myristoylation of methionine sulfoxide reductase A."
    Kim G., Cole N.B., Lim J.C., Zhao H., Levine R.L.
    J. Biol. Chem. 285:18085-18094(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: MYRISTOYLATION (ISOFORM 5), ALTERNATIVE INITIATION.

Entry informationi

Entry nameiMSRA_HUMAN
AccessioniPrimary (citable) accession number: Q9UJ68
Secondary accession number(s): E9PAS8
, Q52TC4, Q549N4, Q66MI7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 1, 2000
Last modified: October 29, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3