Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UII6

- DS13B_HUMAN

UniProt

Q9UII6 - DS13B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Dual specificity protein phosphatase 13 isoform B

Gene

DUSP13

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei138 – 1381Phosphocysteine intermediatePROSITE-ProRule annotation

GO - Molecular functioni

  1. protein tyrosine/serine/threonine phosphatase activity Source: RefGenome
  2. protein tyrosine phosphatase activity Source: UniProtKB-EC

GO - Biological processi

  1. meiotic nuclear division Source: ProtInc
  2. protein dephosphorylation Source: RefGenome
  3. spermatogenesis Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 13 isoform B (EC:3.1.3.16, EC:3.1.3.48)
Short name:
DUSP13B
Alternative name(s):
Dual specificity phosphatase SKRP4
Testis- and skeletal-muscle-specific DSP
Gene namesi
Name:DUSP13
Synonyms:DUSP13B, TMDP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:19681. DUSP13.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134939640.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 198198Dual specificity protein phosphatase 13 isoform BPRO_0000094820Add
BLAST

Proteomic databases

PaxDbiQ9UII6.
PRIDEiQ9UII6.

PTM databases

PhosphoSiteiQ9UII6.

Expressioni

Tissue specificityi

Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level).1 Publication

Gene expression databases

BgeeiQ9UII6.
CleanExiHS_DUSP13.
ExpressionAtlasiQ9UII6. baseline and differential.
GenevestigatoriQ9UII6.

Organism-specific databases

HPAiHPA024162.

Interactioni

Protein-protein interaction databases

BioGridi119380. 1 interaction.
IntActiQ9UII6. 1 interaction.

Structurei

Secondary structure

1
198
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi28 – 3710Combined sources
Beta strandi43 – 508Combined sources
Beta strandi53 – 564Combined sources
Helixi58 – 625Combined sources
Helixi64 – 707Combined sources
Beta strandi74 – 774Combined sources
Helixi88 – 914Combined sources
Turni92 – 943Combined sources
Beta strandi98 – 1014Combined sources
Helixi112 – 1154Combined sources
Helixi116 – 12712Combined sources
Beta strandi129 – 1313Combined sources
Beta strandi134 – 1374Combined sources
Beta strandi139 – 1435Combined sources
Helixi144 – 15613Combined sources
Helixi161 – 1688Combined sources
Turni169 – 1713Combined sources
Helixi178 – 19215Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2GWOX-ray2.40A/B/C/D1-198[»]
2PQ5X-ray2.30A/B/C/D1-198[»]
ProteinModelPortaliQ9UII6.
SMRiQ9UII6. Positions 25-198.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UII6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini114 – 18370Tyrosine-protein phosphataseAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG2453.
GeneTreeiENSGT00760000118853.
HOVERGENiHBG001524.
InParanoidiQ9UII6.
KOiK14165.
OrthoDBiEOG7CZK7N.
PhylomeDBiQ9UII6.
TreeFamiTF105128.

Family and domain databases

Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR020405. Atypical_DUSP_famA.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
PR01909. ADSPHPHTASEA.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9UII6-1) [UniParc]FASTAAdd to Basket

Also known as: TMDP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW
60 70 80 90 100
PSLFLGDAYA ARDKSKLIQL GITHVVNAAA GKFQVDTGAK FYRGMSLEYY
110 120 130 140 150
GIEADDNPFF DLSVYFLPVA RYIRAALSVP QGRVLVHCAM GVSRSATLVL
160 170 180 190
AFLMICENMT LVEAIQTVQA HRNICPNSGF LRQLQVLDNR LGRETGRF

Note: Produced by alternative promoter usage.

Length:198
Mass (Da):22,149
Last modified:September 1, 2009 - v3
Checksum:i82EF05AB74E031EB
GO
Isoform 2 (identifier: Q6B8I1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Length:60
Mass (Da):6,337
GO
Isoform 4 (identifier: Q9UII6-4) [UniParc]FASTAAdd to Basket

Also known as: TMDP-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM

Note: Produced by alternative promoter usage and alternative splicing.

Show »
Length:248
Mass (Da):27,507
Checksum:iA92045D8C086F866
GO
Isoform 5 (identifier: Q6B8I1-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative promoter usage.

Length:188
Mass (Da):20,658
GO
Isoform 6 (identifier: Q6B8I1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Length:67
Mass (Da):7,195
GO
Isoform 7 (identifier: Q6B8I1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Length:92
Mass (Da):9,746
GO
Isoform 8 (identifier: Q6B8I1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Length:166
Mass (Da):17,283
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti82 – 821K → E in CAG33375. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti62 – 621R → Q.
Corresponds to variant rs16932004 [ dbSNP | Ensembl ].
VAR_057130
Natural varianti156 – 1561C → Y.1 Publication
Corresponds to variant rs3088142 [ dbSNP | Ensembl ].
VAR_025431
Natural varianti190 – 1901R → G.
Corresponds to variant rs16931996 [ dbSNP | Ensembl ].
VAR_057131

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4. CuratedVSP_037858

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB027004 mRNA. Translation: BAA89412.1.
AB103375 mRNA. Translation: BAD91014.1.
CR457094 mRNA. Translation: CAG33375.1.
AL392111 Genomic DNA. Translation: CAI40905.1.
CCDSiCCDS31224.1. [Q9UII6-4]
CCDS7346.1. [Q9UII6-1]
RefSeqiNP_057448.3. NM_016364.3. [Q9UII6-1]
XP_005269945.1. XM_005269888.1. [Q9UII6-1]
XP_005269946.1. XM_005269889.1. [Q9UII6-1]
XP_005269947.1. XM_005269890.1. [Q9UII6-1]
UniGeneiHs.178170.

Genome annotation databases

EnsembliENST00000372700; ENSP00000361785; ENSG00000079393. [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393. [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393. [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393. [Q9UII6-1]
GeneIDi51207.
KEGGihsa:51207.
UCSCiuc001jwr.3. human. [Q9UII6-1]
uc001jww.3. human. [Q9UII6-4]

Polymorphism databases

DMDMi257051044.

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB027004 mRNA. Translation: BAA89412.1 .
AB103375 mRNA. Translation: BAD91014.1 .
CR457094 mRNA. Translation: CAG33375.1 .
AL392111 Genomic DNA. Translation: CAI40905.1 .
CCDSi CCDS31224.1. [Q9UII6-4 ]
CCDS7346.1. [Q9UII6-1 ]
RefSeqi NP_057448.3. NM_016364.3. [Q9UII6-1 ]
XP_005269945.1. XM_005269888.1. [Q9UII6-1 ]
XP_005269946.1. XM_005269889.1. [Q9UII6-1 ]
XP_005269947.1. XM_005269890.1. [Q9UII6-1 ]
UniGenei Hs.178170.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2GWO X-ray 2.40 A/B/C/D 1-198 [» ]
2PQ5 X-ray 2.30 A/B/C/D 1-198 [» ]
ProteinModelPortali Q9UII6.
SMRi Q9UII6. Positions 25-198.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119380. 1 interaction.
IntActi Q9UII6. 1 interaction.

PTM databases

PhosphoSitei Q9UII6.

Polymorphism databases

DMDMi 257051044.

Proteomic databases

PaxDbi Q9UII6.
PRIDEi Q9UII6.

Protocols and materials databases

DNASUi 51207.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372700 ; ENSP00000361785 ; ENSG00000079393 . [Q9UII6-4 ]
ENST00000472493 ; ENSP00000444580 ; ENSG00000079393 . [Q9UII6-1 ]
ENST00000491677 ; ENSP00000436312 ; ENSG00000079393 . [Q9UII6-1 ]
ENST00000607131 ; ENSP00000475801 ; ENSG00000079393 . [Q9UII6-1 ]
GeneIDi 51207.
KEGGi hsa:51207.
UCSCi uc001jwr.3. human. [Q9UII6-1 ]
uc001jww.3. human. [Q9UII6-4 ]

Organism-specific databases

CTDi 51207.
GeneCardsi GC10M076854.
HGNCi HGNC:19681. DUSP13.
HPAi HPA024162.
MIMi 613191. gene.
neXtProti NX_Q9UII6.
PharmGKBi PA134939640.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2453.
GeneTreei ENSGT00760000118853.
HOVERGENi HBG001524.
InParanoidi Q9UII6.
KOi K14165.
OrthoDBi EOG7CZK7N.
PhylomeDBi Q9UII6.
TreeFami TF105128.

Miscellaneous databases

EvolutionaryTracei Q9UII6.
GenomeRNAii 51207.
NextBioi 54264.
PROi Q9UII6.
SOURCEi Search...

Gene expression databases

Bgeei Q9UII6.
CleanExi HS_DUSP13.
ExpressionAtlasi Q9UII6. baseline and differential.
Genevestigatori Q9UII6.

Family and domain databases

Gene3Di 3.90.190.10. 1 hit.
InterProi IPR020417. Atypical_DUSP.
IPR020405. Atypical_DUSP_famA.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
[Graphical view ]
PANTHERi PTHR10159. PTHR10159. 1 hit.
Pfami PF00782. DSPc. 1 hit.
[Graphical view ]
PRINTSi PR01908. ADSPHPHTASE.
PR01909. ADSPHPHTASEA.
SMARTi SM00195. DSPc. 1 hit.
[Graphical view ]
SUPFAMi SSF52799. SSF52799. 1 hit.
PROSITEi PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a novel dual-specificity protein phosphatase possibly involved in spermatogenesis."
    Nakamura K., Shima H., Watanabe M., Haneji T., Kikuchi K.
    Biochem. J. 344:819-825(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    Tissue: Skeletal muscle.
  2. "Identification of a novel dual specificity phosphatase, SKRP4."
    Zama T., Aoki R., Murata M., Ikeda Y.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Skeletal muscle.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-156.
  4. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2."
    Chen H.-H., Luche R., Wei B., Tonks N.K.
    J. Biol. Chem. 279:41404-41413(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 4), ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.
  6. "DUSP13B/TMDP inhibits stress-activated MAPKs and suppresses AP-1-dependent gene expression."
    Katagiri C., Masuda K., Nomura M., Tanoue K., Fujita S., Yamashita Y., Katakura R., Shiiba K., Nomura E., Sato M., Tanuma N., Shima H.
    Mol. Cell. Biochem. 352:155-162(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS MAPK8 AND MAPK14 PHOSPHATASE.
  7. "Crystal structure of human TMDP, a testis-specific dual specificity protein phosphatase: implications for substrate specificity."
    Kim S.J., Jeong D.G., Yoon T.S., Son J.H., Cho S.K., Ryu S.E., Kim J.H.
    Proteins 66:239-245(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS).

Entry informationi

Entry nameiDS13B_HUMAN
AccessioniPrimary (citable) accession number: Q9UII6
Secondary accession number(s): A8K776
, A8K782, B3KPY1, B3KXT0, B4DUK0, Q5JSC6, Q6IAR0, Q96GC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: September 1, 2009
Last modified: October 29, 2014
This is version 125 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3