Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UII6 (DS13B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 123. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Dual specificity protein phosphatase 13 isoform B

Short name=DUSP13B
EC=3.1.3.16
EC=3.1.3.48
Alternative name(s):
Dual specificity phosphatase SKRP4
Testis- and skeletal-muscle-specific DSP
Gene names
Name:DUSP13
Synonyms:DUSP13B, TMDP
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length198 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro. Ref.6

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Tissue specificity

Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level). Ref.5

Sequence similarities

Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.

Contains 1 tyrosine-protein phosphatase domain.

Alternative products

This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9UII6-1)

Also known as: TMDP;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Produced by alternative promoter usage.
Isoform 2 (identifier: Q6B8I1-5)

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: Q9UII6-4)

Also known as: TMDP-L2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM
Note: Produced by alternative promoter usage and alternative splicing.
Isoform 5 (identifier: Q6B8I1-1)

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage.
Isoform 6 (identifier: Q6B8I1-2)

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 7 (identifier: Q6B8I1-3)

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Isoform 8 (identifier: Q6B8I1-4)

The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 198198Dual specificity protein phosphatase 13 isoform B
PRO_0000094820

Regions

Domain114 – 18370Tyrosine-protein phosphatase

Sites

Active site1381Phosphocysteine intermediate By similarity

Natural variations

Alternative sequence11M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4.
VSP_037858
Natural variant621R → Q.
Corresponds to variant rs16932004 [ dbSNP | Ensembl ].
VAR_057130
Natural variant1561C → Y. Ref.3
Corresponds to variant rs3088142 [ dbSNP | Ensembl ].
VAR_025431
Natural variant1901R → G.
Corresponds to variant rs16931996 [ dbSNP | Ensembl ].
VAR_057131

Experimental info

Sequence conflict821K → E in CAG33375. Ref.3

Secondary structure

................................. 198
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (TMDP) [UniParc].

Last modified September 1, 2009. Version 3.
Checksum: 82EF05AB74E031EB

FASTA19822,149
        10         20         30         40         50         60 
MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW PSLFLGDAYA 

        70         80         90        100        110        120 
ARDKSKLIQL GITHVVNAAA GKFQVDTGAK FYRGMSLEYY GIEADDNPFF DLSVYFLPVA 

       130        140        150        160        170        180 
RYIRAALSVP QGRVLVHCAM GVSRSATLVL AFLMICENMT LVEAIQTVQA HRNICPNSGF 

       190 
LRQLQVLDNR LGRETGRF 

« Hide

Isoform 2 [UniParc].

See Q6B8I1.

Isoform 4 (TMDP-L2) [UniParc].

Checksum: A92045D8C086F866
Show »

FASTA24827,507
Isoform 5 [UniParc].

See Q6B8I1.

Isoform 6 [UniParc].

See Q6B8I1.

Isoform 7 [UniParc].

See Q6B8I1.

Isoform 8 [UniParc].

See Q6B8I1.

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of a novel dual-specificity protein phosphatase possibly involved in spermatogenesis."
Nakamura K., Shima H., Watanabe M., Haneji T., Kikuchi K.
Biochem. J. 344:819-825(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
Tissue: Skeletal muscle.
[2]"Identification of a novel dual specificity phosphatase, SKRP4."
Zama T., Aoki R., Murata M., Ikeda Y.
Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Skeletal muscle.
[3]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-156.
[4]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2."
Chen H.-H., Luche R., Wei B., Tonks N.K.
J. Biol. Chem. 279:41404-41413(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 4), ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.
[6]"DUSP13B/TMDP inhibits stress-activated MAPKs and suppresses AP-1-dependent gene expression."
Katagiri C., Masuda K., Nomura M., Tanoue K., Fujita S., Yamashita Y., Katakura R., Shiiba K., Nomura E., Sato M., Tanuma N., Shima H.
Mol. Cell. Biochem. 352:155-162(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION AS MAPK8 AND MAPK14 PHOSPHATASE.
[7]"Crystal structure of human TMDP, a testis-specific dual specificity protein phosphatase: implications for substrate specificity."
Kim S.J., Jeong D.G., Yoon T.S., Son J.H., Cho S.K., Ryu S.E., Kim J.H.
Proteins 66:239-245(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB027004 mRNA. Translation: BAA89412.1.
AB103375 mRNA. Translation: BAD91014.1.
CR457094 mRNA. Translation: CAG33375.1.
AL392111 Genomic DNA. Translation: CAI40905.1.
CCDSCCDS31224.1. [Q9UII6-4]
CCDS7346.1. [Q9UII6-1]
RefSeqNP_057448.3. NM_016364.3. [Q9UII6-1]
XP_005269945.1. XM_005269888.1. [Q9UII6-1]
XP_005269946.1. XM_005269889.1. [Q9UII6-1]
XP_005269947.1. XM_005269890.1. [Q9UII6-1]
UniGeneHs.178170.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2GWOX-ray2.40A/B/C/D1-198[»]
2PQ5X-ray2.30A/B/C/D1-198[»]
ProteinModelPortalQ9UII6.
SMRQ9UII6. Positions 25-198.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119380. 1 interaction.
IntActQ9UII6. 1 interaction.

PTM databases

PhosphoSiteQ9UII6.

Polymorphism databases

DMDM257051044.

Proteomic databases

PaxDbQ9UII6.
PRIDEQ9UII6.

Protocols and materials databases

DNASU51207.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000372700; ENSP00000361785; ENSG00000079393. [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393. [Q9UII6-1]
GeneID51207.
KEGGhsa:51207.
UCSCuc001jwr.3. human. [Q9UII6-1]
uc001jww.3. human. [Q9UII6-4]

Organism-specific databases

CTD51207.
GeneCardsGC10M076854.
HGNCHGNC:19681. DUSP13.
HPAHPA024162.
MIM613191. gene.
neXtProtNX_Q9UII6.
PharmGKBPA134939640.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2453.
HOVERGENHBG001524.
InParanoidQ9UII6.
KOK14165.
OrthoDBEOG7CZK7N.
PhylomeDBQ9UII6.
TreeFamTF105128.

Gene expression databases

ArrayExpressQ9UII6.
BgeeQ9UII6.
CleanExHS_DUSP13.
GenevestigatorQ9UII6.

Family and domain databases

Gene3D3.90.190.10. 1 hit.
InterProIPR020417. Atypical_DUSP.
IPR020405. Atypical_DUSP_famA.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR020422. Dual-sp_phosphatase_subgr_cat.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
[Graphical view]
PANTHERPTHR10159. PTHR10159. 1 hit.
PfamPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSPR01908. ADSPHPHTASE.
PR01909. ADSPHPHTASEA.
SMARTSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMSSF52799. SSF52799. 1 hit.
PROSITEPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9UII6.
GenomeRNAi51207.
NextBio54264.
PROQ9UII6.
SOURCESearch...

Entry information

Entry nameDS13B_HUMAN
AccessionPrimary (citable) accession number: Q9UII6
Secondary accession number(s): A8K776 expand/collapse secondary AC list , A8K782, B3KPY1, B3KXT0, B4DUK0, Q5JSC6, Q6IAR0, Q96GC2
Entry history
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: September 1, 2009
Last modified: July 9, 2014
This is version 123 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM