Q9UII6 (DUS13_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dual specificity protein phosphatase 13 EC=3.1.3.16 EC=3.1.3.48 Alternative name(s): Dual specificity phosphatase SKRP4 Testis- and skeletal-muscle-specific DSP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in the regulation of meiosis and/or differentiation of testicular germ cells during spermatogenesis. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues of myelin basic protein, with similar specific activities in vitro. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. A phosphoprotein + H2O = a protein + phosphate. |
| Tissue specificity | Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level). Ref.7 |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. Contains 1 tyrosine-protein phosphatase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | meiosis Traceable author statement Ref.1. Source: ProtInc peptidyl-tyrosine dephosphorylationInferred from electronic annotation. Source: GOC spermatogenesisTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | protein tyrosine phosphatase activity Inferred from electronic annotation. Source: EC protein tyrosine/serine/threonine phosphatase activityInferred from Biological aspect of Ancestor. Source: RefGenome |
| Complete GO annotation... | |
Alternative products
| This entry describes 7 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9UII6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 3 (identifier: Q9UII6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGLPQPRLPA...TAWARYSHRM | ||||||
| Note: Produced by alternative promoter usage and alternative splicing. No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9UII6-4) Also known as: TMDP-L2; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM | ||||||
| Note: Produced by alternative promoter usage and alternative splicing. No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q6B8I1-1) The sequence of this isoform can be found in the external entry Q6B8I1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform 6 (identifier: Q6B8I1-2) The sequence of this isoform can be found in the external entry Q6B8I1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q6B8I1-3) The sequence of this isoform can be found in the external entry Q6B8I1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. | ||||||
| Isoform 8 (identifier: Q6B8I1-4) The sequence of this isoform can be found in the external entry Q6B8I1. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 198 | 198 | Dual specificity protein phosphatase 13 | PRO_0000094820 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 114 – 183 | 70 | Tyrosine-protein phosphatase | ||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||
| Active site | 138 | 1 | Phosphocysteine intermediate By similarity | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGLPQPRLPAPALQAGPATA GCRPELRGQSWSLLPAMGLC HFATLALILLVLLEALAQAD TQKMVEAQRGVGPRACYSIW LLLAPTPPLSHCLQSPQKQH QVCGDRRLKAGSTNCPSEKC TAWARYSHRM in isoform 3. | VSP_037857 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4. | VSP_037858 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 62 | 1 | R → Q. Corresponds to variant rs16932004 [ dbSNP | Ensembl ]. | VAR_057130 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 156 | 1 | C → Y. Ref.3 Ref.4 Ref.6 Corresponds to variant rs3088142 [ dbSNP | Ensembl ]. | VAR_025431 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 190 | 1 | R → G. Corresponds to variant rs16931996 [ dbSNP | Ensembl ]. | VAR_057131 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 82 | 1 | K → E in CAG33375. Ref.4 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 28 – 37 | 10 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 43 – 50 | 8 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 56 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 58 – 62 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 64 – 70 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 74 – 77 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 88 – 91 | 4 | |||||||||||||||||||||||||||||||||||||||
| Turn | 92 – 94 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 101 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 112 – 115 | 4 | |||||||||||||||||||||||||||||||||||||||
| Helix | 116 – 127 | 12 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 131 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 134 – 137 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 139 – 143 | 5 | |||||||||||||||||||||||||||||||||||||||
| Helix | 144 – 156 | 13 | |||||||||||||||||||||||||||||||||||||||
| Helix | 161 – 168 | 8 | |||||||||||||||||||||||||||||||||||||||
| Turn | 169 – 171 | 3 | |||||||||||||||||||||||||||||||||||||||
| Helix | 178 – 192 | 15 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel dual-specificity protein phosphatase possibly involved in spermatogenesis." Nakamura K., Shima H., Watanabe M., Haneji T., Kikuchi K. Biochem. J. 344:819-825(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Skeletal muscle. |
| [2] | "Identification of a novel dual specificity phosphatase, SKRP4." Zama T., Aoki R., Murata M., Ikeda Y. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Skeletal muscle. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT TYR-156. Tissue: Skeletal muscle. |
| [4] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-156. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-156. Tissue: Bone marrow. |
| [7] | "Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2." Chen H.-H., Luche R., Wei B., Tonks N.K. J. Biol. Chem. 279:41404-41413(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY. |
| [8] | "Crystal structure of human TMDP, a testis-specific dual specificity protein phosphatase: implications for substrate specificity." Kim S.J., Jeong D.G., Yoon T.S., Son J.H., Cho S.K., Ryu S.E., Kim J.H. Proteins 66:239-245(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB027004 mRNA. Translation: BAA89412.1. AB103375 mRNA. Translation: BAD91014.1. AK057012 mRNA. Translation: BAG51843.1. AK300679 mRNA. Translation: BAG62362.1. CR457094 mRNA. Translation: CAG33375.1. AL392111 Genomic DNA. Translation: CAI40905.1. BC009778 mRNA. Translation: AAH09778.1. | ||||||||||||||||||
| IPI | IPI00514257. IPI00514507. IPI00973092. IPI01018872. | ||||||||||||||||||
| RefSeq | NP_001007272.1. NM_001007271.1. NP_001007273.1. NM_001007272.1. NP_001007274.1. NM_001007273.1. NP_057448.3. NM_016364.3. | ||||||||||||||||||
| UniGene | Hs.178170. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9UII6. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9UII6. 1 interaction. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9UII6. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 257051044. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9UII6. | ||||||||||||||||||
| PRIDE | Q9UII6. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 51207. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000308475; ENSP00000311051; ENSG00000079393. ENST00000372700; ENSP00000361785; ENSG00000079393. ENST00000394707; ENSP00000452702; ENSG00000079393. ENST00000472493; ENSP00000444580; ENSG00000079393. | ||||||||||||||||||
| GeneID | 51207. | ||||||||||||||||||
| KEGG | hsa:51207. | ||||||||||||||||||
| UCSC | uc001jwr.3. human. uc001jwt.3. human. uc001jww.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 51207. | ||||||||||||||||||
| GeneCards | GC10M076854. | ||||||||||||||||||
| HGNC | HGNC:19681. DUSP13. | ||||||||||||||||||
| HPA | HPA024162. | ||||||||||||||||||
| MIM | 613191. gene. | ||||||||||||||||||
| neXtProt | NX_Q9UII6. | ||||||||||||||||||
| PharmGKB | PA134939640. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG2453. | ||||||||||||||||||
| HOVERGEN | HBG001524. | ||||||||||||||||||
| InParanoid | Q9UII6. | ||||||||||||||||||
| KO | K14165. | ||||||||||||||||||
| OrthoDB | EOG402WSP. | ||||||||||||||||||
| PhylomeDB | Q9UII6. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9UII6. | ||||||||||||||||||
| Bgee | Q9UII6. | ||||||||||||||||||
| CleanEx | HS_DUSP13. | ||||||||||||||||||
| Genevestigator | Q9UII6. | ||||||||||||||||||
| GermOnline | ENSG00000079393. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR020417. Atypical_DUSP. IPR020405. Atypical_DUSP_famA. IPR000340. Dual-sp_phosphatase_cat-dom. IPR020422. Dual-sp_phosphatase_subgr_cat. IPR024950. DUSP. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR10159. PTHR10159. 1 hit. | ||||||||||||||||||
| Pfam | PF00782. DSPc. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR01908. ADSPHPHTASE. PR01909. ADSPHPHTASEA. | ||||||||||||||||||
| SMART | SM00195. DSPc. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00383. TYR_PHOSPHATASE_1. 1 hit. PS50056. TYR_PHOSPHATASE_2. 1 hit. PS50054. TYR_PHOSPHATASE_DUAL. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q9UII6. | ||||||||||||||||||
| GenomeRNAi | 51207. | ||||||||||||||||||
| NextBio | 54264. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | DUS13_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UII6 Secondary accession number(s): A8K776 Q96GC2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
