Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dual specificity protein phosphatase 13 isoform B

Gene

DUSP13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro.1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei138Phosphocysteine intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

  • phosphatase activity Source: UniProtKB
  • protein tyrosine/serine/threonine phosphatase activity Source: ProtInc
  • protein tyrosine phosphatase activity Source: UniProtKB-EC

GO - Biological processi

  • dephosphorylation Source: UniProtKB
  • meiotic nuclear division Source: ProtInc
  • protein dephosphorylation Source: ProtInc
  • spermatogenesis Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciZFISH:HS01326-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Dual specificity protein phosphatase 13 isoform B (EC:3.1.3.16, EC:3.1.3.48)
Short name:
DUSP13B
Alternative name(s):
Dual specificity phosphatase SKRP4
Testis- and skeletal-muscle-specific DSP
Gene namesi
Name:DUSP13
Synonyms:DUSP13B, TMDP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:19681. DUSP13.

Pathology & Biotechi

Organism-specific databases

DisGeNETi51207.
OpenTargetsiENSG00000079393.
PharmGKBiPA134939640.

Polymorphism and mutation databases

BioMutaiDUPD1.
DMDMi257051044.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000948201 – 198Dual specificity protein phosphatase 13 isoform BAdd BLAST198

Proteomic databases

PaxDbiQ9UII6.
PeptideAtlasiQ9UII6.
PRIDEiQ9UII6.

PTM databases

DEPODiQ9UII6.
iPTMnetiQ9UII6.
PhosphoSitePlusiQ9UII6.

Expressioni

Tissue specificityi

Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000079393.
CleanExiHS_DUSP13.
ExpressionAtlasiQ9UII6. baseline and differential.
GenevisibleiQ9UII6. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CALCOCO1Q9P1Z25EBI-749800,EBI-749920
CARD9Q9H2573EBI-749800,EBI-751319
HOOK2Q96ED93EBI-749800,EBI-743290
LMNAP025453EBI-749800,EBI-351935

Protein-protein interaction databases

BioGridi119380. 5 interactors.
IntActiQ9UII6. 9 interactors.
STRINGi9606.ENSP00000452702.

Structurei

Secondary structure

1198
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi28 – 37Combined sources10
Beta strandi43 – 50Combined sources8
Beta strandi53 – 56Combined sources4
Helixi58 – 62Combined sources5
Helixi64 – 70Combined sources7
Beta strandi74 – 77Combined sources4
Helixi88 – 91Combined sources4
Turni92 – 94Combined sources3
Beta strandi98 – 101Combined sources4
Helixi112 – 115Combined sources4
Helixi116 – 127Combined sources12
Beta strandi129 – 131Combined sources3
Beta strandi134 – 137Combined sources4
Beta strandi139 – 143Combined sources5
Helixi144 – 156Combined sources13
Helixi161 – 168Combined sources8
Turni169 – 171Combined sources3
Helixi178 – 192Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GWOX-ray2.40A/B/C/D1-198[»]
2PQ5X-ray2.30A/B/C/D1-198[»]
ProteinModelPortaliQ9UII6.
SMRiQ9UII6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UII6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini114 – 183Tyrosine-protein phosphataseAdd BLAST70

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118853.
HOVERGENiHBG001524.
InParanoidiQ9UII6.
PhylomeDBiQ9UII6.
TreeFamiTF105128.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR020405. Atypical_DUSP_famA.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR016130. Tyr_Pase_AS.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
PR01909. ADSPHPHTASEA.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9UII6-1) [UniParc]FASTAAdd to basket
Also known as: TMDP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW
60 70 80 90 100
PSLFLGDAYA ARDKSKLIQL GITHVVNAAA GKFQVDTGAK FYRGMSLEYY
110 120 130 140 150
GIEADDNPFF DLSVYFLPVA RYIRAALSVP QGRVLVHCAM GVSRSATLVL
160 170 180 190
AFLMICENMT LVEAIQTVQA HRNICPNSGF LRQLQVLDNR LGRETGRF
Note: Produced by alternative promoter usage.
Length:198
Mass (Da):22,149
Last modified:September 1, 2009 - v3
Checksum:i82EF05AB74E031EB
GO
Isoform 2 (identifier: Q6B8I1-5) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:60
Mass (Da):6,337
GO
Isoform 4 (identifier: Q9UII6-4) [UniParc]FASTAAdd to basket
Also known as: TMDP-L2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM

Note: Produced by alternative promoter usage and alternative splicing.
Show »
Length:248
Mass (Da):27,507
Checksum:iA92045D8C086F866
GO
Isoform 5 (identifier: Q6B8I1-1) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage.
Length:188
Mass (Da):20,658
GO
Isoform 6 (identifier: Q6B8I1-2) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:67
Mass (Da):7,195
GO
Isoform 7 (identifier: Q6B8I1-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:92
Mass (Da):9,746
GO
Isoform 8 (identifier: Q6B8I1-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q6B8I1.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Length:166
Mass (Da):17,283
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti82K → E in CAG33375 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05713062R → Q.Corresponds to variant rs16932004dbSNPEnsembl.1
Natural variantiVAR_025431156C → Y.1 PublicationCorresponds to variant rs3088142dbSNPEnsembl.1
Natural variantiVAR_057131190R → G.Corresponds to variant rs16931996dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0378581M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027004 mRNA. Translation: BAA89412.1.
AB103375 mRNA. Translation: BAD91014.1.
CR457094 mRNA. Translation: CAG33375.1.
AL392111 Genomic DNA. Translation: CAI40905.1.
CCDSiCCDS31224.1. [Q9UII6-4]
CCDS7346.1. [Q9UII6-1]
RefSeqiNP_001307772.1. NM_001320843.1. [Q9UII6-1]
NP_057448.3. NM_016364.3. [Q9UII6-1]
XP_005269947.1. XM_005269890.1. [Q9UII6-1]
XP_011538156.1. XM_011539854.2. [Q9UII6-1]
XP_011538157.1. XM_011539855.1. [Q9UII6-1]
XP_011538158.1. XM_011539856.2. [Q9UII6-1]
UniGeneiHs.178170.

Genome annotation databases

EnsembliENST00000372700; ENSP00000361785; ENSG00000079393. [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393. [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393. [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393. [Q9UII6-1]
GeneIDi51207.
UCSCiuc001jwr.4. human. [Q9UII6-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027004 mRNA. Translation: BAA89412.1.
AB103375 mRNA. Translation: BAD91014.1.
CR457094 mRNA. Translation: CAG33375.1.
AL392111 Genomic DNA. Translation: CAI40905.1.
CCDSiCCDS31224.1. [Q9UII6-4]
CCDS7346.1. [Q9UII6-1]
RefSeqiNP_001307772.1. NM_001320843.1. [Q9UII6-1]
NP_057448.3. NM_016364.3. [Q9UII6-1]
XP_005269947.1. XM_005269890.1. [Q9UII6-1]
XP_011538156.1. XM_011539854.2. [Q9UII6-1]
XP_011538157.1. XM_011539855.1. [Q9UII6-1]
XP_011538158.1. XM_011539856.2. [Q9UII6-1]
UniGeneiHs.178170.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2GWOX-ray2.40A/B/C/D1-198[»]
2PQ5X-ray2.30A/B/C/D1-198[»]
ProteinModelPortaliQ9UII6.
SMRiQ9UII6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119380. 5 interactors.
IntActiQ9UII6. 9 interactors.
STRINGi9606.ENSP00000452702.

PTM databases

DEPODiQ9UII6.
iPTMnetiQ9UII6.
PhosphoSitePlusiQ9UII6.

Polymorphism and mutation databases

BioMutaiDUPD1.
DMDMi257051044.

Proteomic databases

PaxDbiQ9UII6.
PeptideAtlasiQ9UII6.
PRIDEiQ9UII6.

Protocols and materials databases

DNASUi51207.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372700; ENSP00000361785; ENSG00000079393. [Q9UII6-4]
ENST00000472493; ENSP00000444580; ENSG00000079393. [Q9UII6-1]
ENST00000491677; ENSP00000436312; ENSG00000079393. [Q9UII6-1]
ENST00000607131; ENSP00000475801; ENSG00000079393. [Q9UII6-1]
GeneIDi51207.
UCSCiuc001jwr.4. human. [Q9UII6-1]

Organism-specific databases

CTDi51207.
DisGeNETi51207.
GeneCardsiDUSP13.
HGNCiHGNC:19681. DUSP13.
MIMi613191. gene.
neXtProtiNX_Q9UII6.
OpenTargetsiENSG00000079393.
PharmGKBiPA134939640.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1716. Eukaryota.
COG2453. LUCA.
GeneTreeiENSGT00760000118853.
HOVERGENiHBG001524.
InParanoidiQ9UII6.
PhylomeDBiQ9UII6.
TreeFamiTF105128.

Enzyme and pathway databases

BioCyciZFISH:HS01326-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ9UII6.
GenomeRNAii51207.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000079393.
CleanExiHS_DUSP13.
ExpressionAtlasiQ9UII6. baseline and differential.
GenevisibleiQ9UII6. HS.

Family and domain databases

CDDicd00127. DSPc. 1 hit.
Gene3Di3.90.190.10. 1 hit.
InterProiIPR020417. Atypical_DUSP.
IPR020405. Atypical_DUSP_famA.
IPR000340. Dual-sp_phosphatase_cat-dom.
IPR024950. DUSP.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR016130. Tyr_Pase_AS.
IPR000387. TYR_PHOSPHATASE_dom.
IPR020422. TYR_PHOSPHATASE_DUAL_dom.
[Graphical view]
PANTHERiPTHR10159. PTHR10159. 1 hit.
PfamiPF00782. DSPc. 1 hit.
[Graphical view]
PRINTSiPR01908. ADSPHPHTASE.
PR01909. ADSPHPHTASEA.
SMARTiSM00195. DSPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDS13B_HUMAN
AccessioniPrimary (citable) accession number: Q9UII6
Secondary accession number(s): A8K776
, A8K782, B3KPY1, B3KXT0, B4DUK0, Q5JSC6, Q6IAR0, Q96GC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: September 1, 2009
Last modified: November 30, 2016
This is version 143 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.