Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UII6

- DS13B_HUMAN

UniProt

Q9UII6 - DS13B_HUMAN

Protein

Dual specificity protein phosphatase 13 isoform B

Gene

DUSP13

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 3 (01 Sep 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Dual specificity phosphatase that dephosphorylates MAPK8/JNK and MAPK14/p38, but not MAPK1/ERK2, in vitro. Exhibits intrinsic phosphatase activity towards both phospho-seryl/threonyl and -tyrosyl residues, with similar specific activities in vitro.1 Publication

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation
    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei138 – 1381Phosphocysteine intermediatePROSITE-ProRule annotation

    GO - Molecular functioni

    1. protein tyrosine/serine/threonine phosphatase activity Source: RefGenome
    2. protein tyrosine phosphatase activity Source: UniProtKB-EC

    GO - Biological processi

    1. meiotic nuclear division Source: ProtInc
    2. protein dephosphorylation Source: RefGenome
    3. spermatogenesis Source: ProtInc

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dual specificity protein phosphatase 13 isoform B (EC:3.1.3.16, EC:3.1.3.48)
    Short name:
    DUSP13B
    Alternative name(s):
    Dual specificity phosphatase SKRP4
    Testis- and skeletal-muscle-specific DSP
    Gene namesi
    Name:DUSP13
    Synonyms:DUSP13B, TMDP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:19681. DUSP13.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134939640.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 198198Dual specificity protein phosphatase 13 isoform BPRO_0000094820Add
    BLAST

    Proteomic databases

    PaxDbiQ9UII6.
    PRIDEiQ9UII6.

    PTM databases

    PhosphoSiteiQ9UII6.

    Expressioni

    Tissue specificityi

    Most abundantly expressed in the testis. Also found in the skeletal muscle. Testis-specific (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ9UII6.
    BgeeiQ9UII6.
    CleanExiHS_DUSP13.
    GenevestigatoriQ9UII6.

    Organism-specific databases

    HPAiHPA024162.

    Interactioni

    Protein-protein interaction databases

    BioGridi119380. 1 interaction.
    IntActiQ9UII6. 1 interaction.

    Structurei

    Secondary structure

    1
    198
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi28 – 3710
    Beta strandi43 – 508
    Beta strandi53 – 564
    Helixi58 – 625
    Helixi64 – 707
    Beta strandi74 – 774
    Helixi88 – 914
    Turni92 – 943
    Beta strandi98 – 1014
    Helixi112 – 1154
    Helixi116 – 12712
    Beta strandi129 – 1313
    Beta strandi134 – 1374
    Beta strandi139 – 1435
    Helixi144 – 15613
    Helixi161 – 1688
    Turni169 – 1713
    Helixi178 – 19215

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2GWOX-ray2.40A/B/C/D1-198[»]
    2PQ5X-ray2.30A/B/C/D1-198[»]
    ProteinModelPortaliQ9UII6.
    SMRiQ9UII6. Positions 25-198.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9UII6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini114 – 18370Tyrosine-protein phosphataseAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG2453.
    HOVERGENiHBG001524.
    InParanoidiQ9UII6.
    KOiK14165.
    OrthoDBiEOG7CZK7N.
    PhylomeDBiQ9UII6.
    TreeFamiTF105128.

    Family and domain databases

    Gene3Di3.90.190.10. 1 hit.
    InterProiIPR020417. Atypical_DUSP.
    IPR020405. Atypical_DUSP_famA.
    IPR000340. Dual-sp_phosphatase_cat-dom.
    IPR020422. Dual-sp_phosphatase_subgr_cat.
    IPR024950. DUSP.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    [Graphical view]
    PANTHERiPTHR10159. PTHR10159. 1 hit.
    PfamiPF00782. DSPc. 1 hit.
    [Graphical view]
    PRINTSiPR01908. ADSPHPHTASE.
    PR01909. ADSPHPHTASEA.
    SMARTiSM00195. DSPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF52799. SSF52799. 1 hit.
    PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
    PS50056. TYR_PHOSPHATASE_2. 1 hit.
    PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9UII6-1) [UniParc]FASTAAdd to Basket

    Also known as: TMDP

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDSLQKQDLR RPKIHGAVQA SPYQPPTLAS LQRLLWVRQA ATLNHIDEVW    50
    PSLFLGDAYA ARDKSKLIQL GITHVVNAAA GKFQVDTGAK FYRGMSLEYY 100
    GIEADDNPFF DLSVYFLPVA RYIRAALSVP QGRVLVHCAM GVSRSATLVL 150
    AFLMICENMT LVEAIQTVQA HRNICPNSGF LRQLQVLDNR LGRETGRF 198

    Note: Produced by alternative promoter usage.

    Length:198
    Mass (Da):22,149
    Last modified:September 1, 2009 - v3
    Checksum:i82EF05AB74E031EB
    GO
    Isoform 2 (identifier: Q6B8I1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q6B8I1.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Length:60
    Mass (Da):6,337
    GO
    Isoform 4 (identifier: Q9UII6-4) [UniParc]FASTAAdd to Basket

    Also known as: TMDP-L2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAM

    Note: Produced by alternative promoter usage and alternative splicing.

    Show »
    Length:248
    Mass (Da):27,507
    Checksum:iA92045D8C086F866
    GO
    Isoform 5 (identifier: Q6B8I1-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q6B8I1.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative promoter usage.

    Length:188
    Mass (Da):20,658
    GO
    Isoform 6 (identifier: Q6B8I1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q6B8I1.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Length:67
    Mass (Da):7,195
    GO
    Isoform 7 (identifier: Q6B8I1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q6B8I1.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Length:92
    Mass (Da):9,746
    GO
    Isoform 8 (identifier: Q6B8I1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform can be found in the external entry Q6B8I1.
    Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

    Note: Produced by alternative promoter usage and alternative splicing. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.

    Length:166
    Mass (Da):17,283
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti82 – 821K → E in CAG33375. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti62 – 621R → Q.
    Corresponds to variant rs16932004 [ dbSNP | Ensembl ].
    VAR_057130
    Natural varianti156 – 1561C → Y.1 Publication
    Corresponds to variant rs3088142 [ dbSNP | Ensembl ].
    VAR_025431
    Natural varianti190 – 1901R → G.
    Corresponds to variant rs16931996 [ dbSNP | Ensembl ].
    VAR_057131

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MAETSLPELGGEDKATPCPS ILELEELLRAGKSSCSRVDE VWPNLFIGDAM in isoform 4. CuratedVSP_037858

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB027004 mRNA. Translation: BAA89412.1.
    AB103375 mRNA. Translation: BAD91014.1.
    CR457094 mRNA. Translation: CAG33375.1.
    AL392111 Genomic DNA. Translation: CAI40905.1.
    CCDSiCCDS31224.1. [Q9UII6-4]
    CCDS7346.1. [Q9UII6-1]
    RefSeqiNP_057448.3. NM_016364.3. [Q9UII6-1]
    XP_005269945.1. XM_005269888.1. [Q9UII6-1]
    XP_005269946.1. XM_005269889.1. [Q9UII6-1]
    XP_005269947.1. XM_005269890.1. [Q9UII6-1]
    UniGeneiHs.178170.

    Genome annotation databases

    EnsembliENST00000372700; ENSP00000361785; ENSG00000079393. [Q9UII6-4]
    ENST00000472493; ENSP00000444580; ENSG00000079393. [Q9UII6-1]
    GeneIDi51207.
    KEGGihsa:51207.
    UCSCiuc001jwr.3. human. [Q9UII6-1]
    uc001jww.3. human. [Q9UII6-4]

    Polymorphism databases

    DMDMi257051044.

    Keywords - Coding sequence diversityi

    Alternative promoter usage, Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB027004 mRNA. Translation: BAA89412.1 .
    AB103375 mRNA. Translation: BAD91014.1 .
    CR457094 mRNA. Translation: CAG33375.1 .
    AL392111 Genomic DNA. Translation: CAI40905.1 .
    CCDSi CCDS31224.1. [Q9UII6-4 ]
    CCDS7346.1. [Q9UII6-1 ]
    RefSeqi NP_057448.3. NM_016364.3. [Q9UII6-1 ]
    XP_005269945.1. XM_005269888.1. [Q9UII6-1 ]
    XP_005269946.1. XM_005269889.1. [Q9UII6-1 ]
    XP_005269947.1. XM_005269890.1. [Q9UII6-1 ]
    UniGenei Hs.178170.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2GWO X-ray 2.40 A/B/C/D 1-198 [» ]
    2PQ5 X-ray 2.30 A/B/C/D 1-198 [» ]
    ProteinModelPortali Q9UII6.
    SMRi Q9UII6. Positions 25-198.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119380. 1 interaction.
    IntActi Q9UII6. 1 interaction.

    PTM databases

    PhosphoSitei Q9UII6.

    Polymorphism databases

    DMDMi 257051044.

    Proteomic databases

    PaxDbi Q9UII6.
    PRIDEi Q9UII6.

    Protocols and materials databases

    DNASUi 51207.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372700 ; ENSP00000361785 ; ENSG00000079393 . [Q9UII6-4 ]
    ENST00000472493 ; ENSP00000444580 ; ENSG00000079393 . [Q9UII6-1 ]
    GeneIDi 51207.
    KEGGi hsa:51207.
    UCSCi uc001jwr.3. human. [Q9UII6-1 ]
    uc001jww.3. human. [Q9UII6-4 ]

    Organism-specific databases

    CTDi 51207.
    GeneCardsi GC10M076854.
    HGNCi HGNC:19681. DUSP13.
    HPAi HPA024162.
    MIMi 613191. gene.
    neXtProti NX_Q9UII6.
    PharmGKBi PA134939640.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2453.
    HOVERGENi HBG001524.
    InParanoidi Q9UII6.
    KOi K14165.
    OrthoDBi EOG7CZK7N.
    PhylomeDBi Q9UII6.
    TreeFami TF105128.

    Miscellaneous databases

    EvolutionaryTracei Q9UII6.
    GenomeRNAii 51207.
    NextBioi 54264.
    PROi Q9UII6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UII6.
    Bgeei Q9UII6.
    CleanExi HS_DUSP13.
    Genevestigatori Q9UII6.

    Family and domain databases

    Gene3Di 3.90.190.10. 1 hit.
    InterProi IPR020417. Atypical_DUSP.
    IPR020405. Atypical_DUSP_famA.
    IPR000340. Dual-sp_phosphatase_cat-dom.
    IPR020422. Dual-sp_phosphatase_subgr_cat.
    IPR024950. DUSP.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    [Graphical view ]
    PANTHERi PTHR10159. PTHR10159. 1 hit.
    Pfami PF00782. DSPc. 1 hit.
    [Graphical view ]
    PRINTSi PR01908. ADSPHPHTASE.
    PR01909. ADSPHPHTASEA.
    SMARTi SM00195. DSPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52799. SSF52799. 1 hit.
    PROSITEi PS00383. TYR_PHOSPHATASE_1. 1 hit.
    PS50056. TYR_PHOSPHATASE_2. 1 hit.
    PS50054. TYR_PHOSPHATASE_DUAL. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of a novel dual-specificity protein phosphatase possibly involved in spermatogenesis."
      Nakamura K., Shima H., Watanabe M., Haneji T., Kikuchi K.
      Biochem. J. 344:819-825(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
      Tissue: Skeletal muscle.
    2. "Identification of a novel dual specificity phosphatase, SKRP4."
      Zama T., Aoki R., Murata M., Ikeda Y.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Skeletal muscle.
    3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT TYR-156.
    4. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Characterization of two distinct dual specificity phosphatases encoded in alternative open reading frames of a single gene located on human chromosome 10q22.2."
      Chen H.-H., Luche R., Wei B., Tonks N.K.
      J. Biol. Chem. 279:41404-41413(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING (ISOFORMS 1 AND 4), ALTERNATIVE PROMOTER USAGE, TISSUE SPECIFICITY.
    6. "DUSP13B/TMDP inhibits stress-activated MAPKs and suppresses AP-1-dependent gene expression."
      Katagiri C., Masuda K., Nomura M., Tanoue K., Fujita S., Yamashita Y., Katakura R., Shiiba K., Nomura E., Sato M., Tanuma N., Shima H.
      Mol. Cell. Biochem. 352:155-162(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION AS MAPK8 AND MAPK14 PHOSPHATASE.
    7. "Crystal structure of human TMDP, a testis-specific dual specificity protein phosphatase: implications for substrate specificity."
      Kim S.J., Jeong D.G., Yoon T.S., Son J.H., Cho S.K., Ryu S.E., Kim J.H.
      Proteins 66:239-245(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS).

    Entry informationi

    Entry nameiDS13B_HUMAN
    AccessioniPrimary (citable) accession number: Q9UII6
    Secondary accession number(s): A8K776
    , A8K782, B3KPY1, B3KXT0, B4DUK0, Q5JSC6, Q6IAR0, Q96GC2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2002
    Last sequence update: September 1, 2009
    Last modified: October 1, 2014
    This is version 124 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3