Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Importin-11

Gene

IPO11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of UBE2E3, and of RPL12 (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Protein family/group databases

TCDBi1.I.1.1.3. the nuclear pore complex (npc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Importin-11
Short name:
Imp11
Alternative name(s):
Ran-binding protein 11
Short name:
RanBP11
Gene namesi
Name:IPO11
Synonyms:RANBP11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:20628. IPO11.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51194.
OpenTargetsiENSG00000086200.
PharmGKBiPA134936197.

Polymorphism and mutation databases

BioMutaiIPO11.
DMDMi50401199.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001207561 – 975Importin-11Add BLAST975

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei343PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9UI26.
PaxDbiQ9UI26.
PeptideAtlasiQ9UI26.
PRIDEiQ9UI26.

PTM databases

iPTMnetiQ9UI26.
PhosphoSitePlusiQ9UI26.

Expressioni

Gene expression databases

BgeeiENSG00000086200.
CleanExiHS_IPO11.
ExpressionAtlasiQ9UI26. baseline and differential.
GenevisibleiQ9UI26. HS.

Organism-specific databases

HPAiHPA067097.

Interactioni

Subunit structurei

Interacts with UBE2E3 and RPL12.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
C1orf94Q6P1W53EBI-748752,EBI-946029
EIF4A2Q142403EBI-748752,EBI-73473

Protein-protein interaction databases

BioGridi119368. 70 interactors.
IntActiQ9UI26. 9 interactors.
MINTiMINT-1460740.
STRINGi9606.ENSP00000386992.

Structurei

3D structure databases

ProteinModelPortaliQ9UI26.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini28 – 100Importin N-terminalPROSITE-ProRule annotationAdd BLAST73
Repeati123 – 160HEAT 1Add BLAST38
Repeati209 – 248HEAT 2Add BLAST40
Repeati318 – 356HEAT 3Add BLAST39
Repeati422 – 459HEAT 4Add BLAST38
Repeati473 – 509HEAT 5Add BLAST37
Repeati511 – 548HEAT 6Add BLAST38
Repeati555 – 593HEAT 7Add BLAST39
Repeati600 – 636HEAT 8Add BLAST37
Repeati640 – 677HEAT 9Add BLAST38
Repeati683 – 720HEAT 10Add BLAST38
Repeati743 – 764HEAT 11Add BLAST22
Repeati765 – 804HEAT 12Add BLAST40
Repeati819 – 849HEAT 13Add BLAST31
Repeati850 – 887HEAT 14Add BLAST38
Repeati957 – 974HEAT 15Add BLAST18

Sequence similaritiesi

Belongs to the importin beta family.Curated
Contains 15 HEAT repeats.Curated
Contains 1 importin N-terminal domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1993. Eukaryota.
COG5657. LUCA.
GeneTreeiENSGT00390000014071.
HOGENOMiHOG000008140.
HOVERGENiHBG061387.
InParanoidiQ9UI26.
OMAiLLLIRAC.
OrthoDBiEOG091G01EL.
PhylomeDBiQ9UI26.
TreeFamiTF324336.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR001494. Importin-beta_N.
[Graphical view]
PfamiPF03810. IBN_N. 1 hit.
[Graphical view]
SMARTiSM00913. IBN_N. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50166. IMPORTIN_B_NT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UI26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLNSASTVV LQVLTQATSQ DTAVLKPAEE QLKQWETQPG FYSVLLNIFT
60 70 80 90 100
NHTLDINVRW LAVLYFKHGI DRYWRRVAPH ALSEEEKTTL RAGLITNFNE
110 120 130 140 150
PINQIATQIA VLIAKVARLD CPRQWPELIP TLIESVKVQD DLRQHRALLT
160 170 180 190 200
FYHVTKTLAS KRLAADRKLF YDLASGIYNF ACSLWNHHTD TFLQEVSSGN
210 220 230 240 250
EAAILSSLER TLLSLKVLRK LTVNGFVEPH KNMEVMGFLH GIFERLKQFL
260 270 280 290 300
ECSRSIGTDN VCRDRLEKTI ILFTKVLLDF LDQHPFSFTP LIQRSLEFSV
310 320 330 340 350
SYVFTEVGEG VTFERFIVQC MNLIKMIVKN YAYKPSKNFE DSSPETLEAH
360 370 380 390 400
KIKMAFFTYP TLTEICRRLV SHYFLLTEEE LTMWEEDPEG FTVEETGGDS
410 420 430 440 450
WKYSLRPCTE VLFIDIFHEY NQTLTPVLLE MMQTLQGPTN VEDMNALLIK
460 470 480 490 500
DAVYNAVGLA AYELFDSVDF DQWFKNQLLP ELQVIHNRYK PLRRRVIWLI
510 520 530 540 550
GQWISVKFKS DLRPMLYEAI CNLLQDQDLV VRIETATTLK LTVDDFEFRT
560 570 580 590 600
DQFLPYLETM FTLLFQLLQQ VTECDTKMHV LHVLSCVIER VNMQIRPYVG
610 620 630 640 650
CLVQYLPLLW KQSEEHNMLR CAILTTLIHL VQGLGADSKN LYPFLLPVIQ
660 670 680 690 700
LSTDVSQPPH VYLLEDGLEL WLVTLENSPC ITPELLRIFQ NMSPLLELSS
710 720 730 740 750
ENLRTCFKII NGYIFLSSTE FLQTYAVGLC QSFCELLKEI TTEGQVQVLK
760 770 780 790 800
VVENALKVNP ILGPQMFQPI LPYVFKGIIE GERYPVVMST YLGVMGRVLL
810 820 830 840 850
QNTSFFSSLL NEMAHKFNQE MDQLLGNMIE MWVDRMDNIT QPERRKLSAL
860 870 880 890 900
ALLSLLPSDN SVIQDKFCGI INISVEGLHD VMTEDPETGT YKDCMLMSHL
910 920 930 940 950
EEPKVTEDEE PPTEQDKRKK MLALKDPVHT VSLQQFIYEK LKAQQEMLGE
960 970
QGFQSLMETV DTEIVTQLQE FLQGF
Length:975
Mass (Da):112,535
Last modified:May 1, 2000 - v1
Checksum:i6A9349B2F8F36DF9
GO
Isoform 2 (identifier: Q9UI26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQPIIHLGYVVYSLLYLGYKPVQHVTALNTVSSCHKMVSM

Show »
Length:1,015
Mass (Da):117,008
Checksum:iA742D05B81FBD368
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti53T → A in BAG63985 (PubMed:14702039).Curated1
Sequence conflicti204I → T in BAA91843 (PubMed:14702039).Curated1
Sequence conflicti237G → V in BAG63985 (PubMed:14702039).Curated1
Sequence conflicti332A → T in BAG63985 (PubMed:14702039).Curated1
Sequence conflicti504I → V in BAA91843 (PubMed:14702039).Curated1
Sequence conflicti571V → A in BAA91843 (PubMed:14702039).Curated1
Sequence conflicti722L → S in BAG63985 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050004260N → D.Corresponds to variant rs35107530dbSNPEnsembl.1
Natural variantiVAR_050005937I → V.Corresponds to variant rs11544795dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414201M → MVQPIIHLGYVVYSLLYLGY KPVQHVTALNTVSSCHKMVS M in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111109 mRNA. Translation: AAF21936.1.
AK302781 mRNA. Translation: BAG63985.1.
AK001696 mRNA. Translation: BAA91843.1.
AC008859 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51379.1.
CH471137 Genomic DNA. Translation: EAW51380.1.
BC031694 mRNA. Translation: AAH31694.1.
BC033776 mRNA. Translation: AAH33776.1.
AL162083 mRNA. Translation: CAB82416.1.
CCDSiCCDS34167.1. [Q9UI26-1]
CCDS47217.1. [Q9UI26-2]
PIRiT47185.
RefSeqiNP_001128251.1. NM_001134779.1. [Q9UI26-2]
NP_057422.3. NM_016338.4. [Q9UI26-1]
UniGeneiHs.482269.

Genome annotation databases

EnsembliENST00000325324; ENSP00000316651; ENSG00000086200. [Q9UI26-1]
ENST00000409296; ENSP00000386992; ENSG00000086200. [Q9UI26-2]
GeneIDi51194.
KEGGihsa:51194.
UCSCiuc003jtc.4. human. [Q9UI26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111109 mRNA. Translation: AAF21936.1.
AK302781 mRNA. Translation: BAG63985.1.
AK001696 mRNA. Translation: BAA91843.1.
AC008859 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51379.1.
CH471137 Genomic DNA. Translation: EAW51380.1.
BC031694 mRNA. Translation: AAH31694.1.
BC033776 mRNA. Translation: AAH33776.1.
AL162083 mRNA. Translation: CAB82416.1.
CCDSiCCDS34167.1. [Q9UI26-1]
CCDS47217.1. [Q9UI26-2]
PIRiT47185.
RefSeqiNP_001128251.1. NM_001134779.1. [Q9UI26-2]
NP_057422.3. NM_016338.4. [Q9UI26-1]
UniGeneiHs.482269.

3D structure databases

ProteinModelPortaliQ9UI26.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119368. 70 interactors.
IntActiQ9UI26. 9 interactors.
MINTiMINT-1460740.
STRINGi9606.ENSP00000386992.

Protein family/group databases

TCDBi1.I.1.1.3. the nuclear pore complex (npc) family.

PTM databases

iPTMnetiQ9UI26.
PhosphoSitePlusiQ9UI26.

Polymorphism and mutation databases

BioMutaiIPO11.
DMDMi50401199.

Proteomic databases

EPDiQ9UI26.
PaxDbiQ9UI26.
PeptideAtlasiQ9UI26.
PRIDEiQ9UI26.

Protocols and materials databases

DNASUi51194.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325324; ENSP00000316651; ENSG00000086200. [Q9UI26-1]
ENST00000409296; ENSP00000386992; ENSG00000086200. [Q9UI26-2]
GeneIDi51194.
KEGGihsa:51194.
UCSCiuc003jtc.4. human. [Q9UI26-1]

Organism-specific databases

CTDi51194.
DisGeNETi51194.
GeneCardsiIPO11.
HGNCiHGNC:20628. IPO11.
HPAiHPA067097.
MIMi610889. gene.
neXtProtiNX_Q9UI26.
OpenTargetsiENSG00000086200.
PharmGKBiPA134936197.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1993. Eukaryota.
COG5657. LUCA.
GeneTreeiENSGT00390000014071.
HOGENOMiHOG000008140.
HOVERGENiHBG061387.
InParanoidiQ9UI26.
OMAiLLLIRAC.
OrthoDBiEOG091G01EL.
PhylomeDBiQ9UI26.
TreeFamiTF324336.

Miscellaneous databases

ChiTaRSiIPO11. human.
GeneWikiiIPO11.
GenomeRNAii51194.
PROiQ9UI26.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000086200.
CleanExiHS_IPO11.
ExpressionAtlasiQ9UI26. baseline and differential.
GenevisibleiQ9UI26. HS.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR001494. Importin-beta_N.
[Graphical view]
PfamiPF03810. IBN_N. 1 hit.
[Graphical view]
SMARTiSM00913. IBN_N. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50166. IMPORTIN_B_NT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIPO11_HUMAN
AccessioniPrimary (citable) accession number: Q9UI26
Secondary accession number(s): A6NGJ5
, B4DZ73, D3DW98, Q8N5R2, Q9NSJ6, Q9NVB1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.