Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Importin-11

Gene

IPO11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Mediates the nuclear import of UBE2E3, and of RPL12 (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Protein family/group databases

TCDBi1.I.1.1.3. the nuclear pore complex (npc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Importin-11
Short name:
Imp11
Alternative name(s):
Ran-binding protein 11
Short name:
RanBP11
Gene namesi
Name:IPO11
Synonyms:RANBP11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:20628. IPO11.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Nucleus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134936197.

Polymorphism and mutation databases

BioMutaiIPO11.
DMDMi50401199.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 975975Importin-11PRO_0000120756Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9UI26.
MaxQBiQ9UI26.
PaxDbiQ9UI26.
PeptideAtlasiQ9UI26.
PRIDEiQ9UI26.

PTM databases

iPTMnetiQ9UI26.
PhosphoSiteiQ9UI26.

Expressioni

Gene expression databases

BgeeiQ9UI26.
CleanExiHS_IPO11.
ExpressionAtlasiQ9UI26. baseline and differential.
GenevisibleiQ9UI26. HS.

Interactioni

Subunit structurei

Interacts with UBE2E3 and RPL12.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
C1orf94Q6P1W53EBI-748752,EBI-946029
EIF4A2Q142403EBI-748752,EBI-73473

Protein-protein interaction databases

BioGridi119368. 70 interactions.
IntActiQ9UI26. 7 interactions.
MINTiMINT-1460740.
STRINGi9606.ENSP00000386992.

Structurei

3D structure databases

ProteinModelPortaliQ9UI26.
SMRiQ9UI26. Positions 10-540.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini28 – 10073Importin N-terminalPROSITE-ProRule annotationAdd
BLAST
Repeati123 – 16038HEAT 1Add
BLAST
Repeati209 – 24840HEAT 2Add
BLAST
Repeati318 – 35639HEAT 3Add
BLAST
Repeati422 – 45938HEAT 4Add
BLAST
Repeati473 – 50937HEAT 5Add
BLAST
Repeati511 – 54838HEAT 6Add
BLAST
Repeati555 – 59339HEAT 7Add
BLAST
Repeati600 – 63637HEAT 8Add
BLAST
Repeati640 – 67738HEAT 9Add
BLAST
Repeati683 – 72038HEAT 10Add
BLAST
Repeati743 – 76422HEAT 11Add
BLAST
Repeati765 – 80440HEAT 12Add
BLAST
Repeati819 – 84931HEAT 13Add
BLAST
Repeati850 – 88738HEAT 14Add
BLAST
Repeati957 – 97418HEAT 15Add
BLAST

Sequence similaritiesi

Belongs to the importin beta family.Curated
Contains 15 HEAT repeats.Curated
Contains 1 importin N-terminal domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1993. Eukaryota.
COG5657. LUCA.
GeneTreeiENSGT00390000014071.
HOGENOMiHOG000008140.
HOVERGENiHBG061387.
InParanoidiQ9UI26.
OMAiLLLIRAC.
PhylomeDBiQ9UI26.
TreeFamiTF324336.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR001494. Importin-beta_N.
[Graphical view]
PfamiPF03810. IBN_N. 1 hit.
[Graphical view]
SMARTiSM00913. IBN_N. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50166. IMPORTIN_B_NT. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UI26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLNSASTVV LQVLTQATSQ DTAVLKPAEE QLKQWETQPG FYSVLLNIFT
60 70 80 90 100
NHTLDINVRW LAVLYFKHGI DRYWRRVAPH ALSEEEKTTL RAGLITNFNE
110 120 130 140 150
PINQIATQIA VLIAKVARLD CPRQWPELIP TLIESVKVQD DLRQHRALLT
160 170 180 190 200
FYHVTKTLAS KRLAADRKLF YDLASGIYNF ACSLWNHHTD TFLQEVSSGN
210 220 230 240 250
EAAILSSLER TLLSLKVLRK LTVNGFVEPH KNMEVMGFLH GIFERLKQFL
260 270 280 290 300
ECSRSIGTDN VCRDRLEKTI ILFTKVLLDF LDQHPFSFTP LIQRSLEFSV
310 320 330 340 350
SYVFTEVGEG VTFERFIVQC MNLIKMIVKN YAYKPSKNFE DSSPETLEAH
360 370 380 390 400
KIKMAFFTYP TLTEICRRLV SHYFLLTEEE LTMWEEDPEG FTVEETGGDS
410 420 430 440 450
WKYSLRPCTE VLFIDIFHEY NQTLTPVLLE MMQTLQGPTN VEDMNALLIK
460 470 480 490 500
DAVYNAVGLA AYELFDSVDF DQWFKNQLLP ELQVIHNRYK PLRRRVIWLI
510 520 530 540 550
GQWISVKFKS DLRPMLYEAI CNLLQDQDLV VRIETATTLK LTVDDFEFRT
560 570 580 590 600
DQFLPYLETM FTLLFQLLQQ VTECDTKMHV LHVLSCVIER VNMQIRPYVG
610 620 630 640 650
CLVQYLPLLW KQSEEHNMLR CAILTTLIHL VQGLGADSKN LYPFLLPVIQ
660 670 680 690 700
LSTDVSQPPH VYLLEDGLEL WLVTLENSPC ITPELLRIFQ NMSPLLELSS
710 720 730 740 750
ENLRTCFKII NGYIFLSSTE FLQTYAVGLC QSFCELLKEI TTEGQVQVLK
760 770 780 790 800
VVENALKVNP ILGPQMFQPI LPYVFKGIIE GERYPVVMST YLGVMGRVLL
810 820 830 840 850
QNTSFFSSLL NEMAHKFNQE MDQLLGNMIE MWVDRMDNIT QPERRKLSAL
860 870 880 890 900
ALLSLLPSDN SVIQDKFCGI INISVEGLHD VMTEDPETGT YKDCMLMSHL
910 920 930 940 950
EEPKVTEDEE PPTEQDKRKK MLALKDPVHT VSLQQFIYEK LKAQQEMLGE
960 970
QGFQSLMETV DTEIVTQLQE FLQGF
Length:975
Mass (Da):112,535
Last modified:May 1, 2000 - v1
Checksum:i6A9349B2F8F36DF9
GO
Isoform 2 (identifier: Q9UI26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVQPIIHLGYVVYSLLYLGYKPVQHVTALNTVSSCHKMVSM

Show »
Length:1,015
Mass (Da):117,008
Checksum:iA742D05B81FBD368
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti53 – 531T → A in BAG63985 (PubMed:14702039).Curated
Sequence conflicti204 – 2041I → T in BAA91843 (PubMed:14702039).Curated
Sequence conflicti237 – 2371G → V in BAG63985 (PubMed:14702039).Curated
Sequence conflicti332 – 3321A → T in BAG63985 (PubMed:14702039).Curated
Sequence conflicti504 – 5041I → V in BAA91843 (PubMed:14702039).Curated
Sequence conflicti571 – 5711V → A in BAA91843 (PubMed:14702039).Curated
Sequence conflicti722 – 7221L → S in BAG63985 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti260 – 2601N → D.
Corresponds to variant rs35107530 [ dbSNP | Ensembl ].
VAR_050004
Natural varianti937 – 9371I → V.
Corresponds to variant rs11544795 [ dbSNP | Ensembl ].
VAR_050005

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MVQPIIHLGYVVYSLLYLGY KPVQHVTALNTVSSCHKMVS M in isoform 2. 1 PublicationVSP_041420

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111109 mRNA. Translation: AAF21936.1.
AK302781 mRNA. Translation: BAG63985.1.
AK001696 mRNA. Translation: BAA91843.1.
AC008859 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51379.1.
CH471137 Genomic DNA. Translation: EAW51380.1.
BC031694 mRNA. Translation: AAH31694.1.
BC033776 mRNA. Translation: AAH33776.1.
AL162083 mRNA. Translation: CAB82416.1.
CCDSiCCDS34167.1. [Q9UI26-1]
CCDS47217.1. [Q9UI26-2]
PIRiT47185.
RefSeqiNP_001128251.1. NM_001134779.1. [Q9UI26-2]
NP_057422.3. NM_016338.4. [Q9UI26-1]
UniGeneiHs.482269.

Genome annotation databases

EnsembliENST00000325324; ENSP00000316651; ENSG00000086200. [Q9UI26-1]
ENST00000409296; ENSP00000386992; ENSG00000086200. [Q9UI26-2]
GeneIDi51194.
KEGGihsa:51194.
UCSCiuc003jtc.4. human. [Q9UI26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF111109 mRNA. Translation: AAF21936.1.
AK302781 mRNA. Translation: BAG63985.1.
AK001696 mRNA. Translation: BAA91843.1.
AC008859 Genomic DNA. No translation available.
CH471137 Genomic DNA. Translation: EAW51379.1.
CH471137 Genomic DNA. Translation: EAW51380.1.
BC031694 mRNA. Translation: AAH31694.1.
BC033776 mRNA. Translation: AAH33776.1.
AL162083 mRNA. Translation: CAB82416.1.
CCDSiCCDS34167.1. [Q9UI26-1]
CCDS47217.1. [Q9UI26-2]
PIRiT47185.
RefSeqiNP_001128251.1. NM_001134779.1. [Q9UI26-2]
NP_057422.3. NM_016338.4. [Q9UI26-1]
UniGeneiHs.482269.

3D structure databases

ProteinModelPortaliQ9UI26.
SMRiQ9UI26. Positions 10-540.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119368. 70 interactions.
IntActiQ9UI26. 7 interactions.
MINTiMINT-1460740.
STRINGi9606.ENSP00000386992.

Protein family/group databases

TCDBi1.I.1.1.3. the nuclear pore complex (npc) family.

PTM databases

iPTMnetiQ9UI26.
PhosphoSiteiQ9UI26.

Polymorphism and mutation databases

BioMutaiIPO11.
DMDMi50401199.

Proteomic databases

EPDiQ9UI26.
MaxQBiQ9UI26.
PaxDbiQ9UI26.
PeptideAtlasiQ9UI26.
PRIDEiQ9UI26.

Protocols and materials databases

DNASUi51194.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325324; ENSP00000316651; ENSG00000086200. [Q9UI26-1]
ENST00000409296; ENSP00000386992; ENSG00000086200. [Q9UI26-2]
GeneIDi51194.
KEGGihsa:51194.
UCSCiuc003jtc.4. human. [Q9UI26-1]

Organism-specific databases

CTDi51194.
GeneCardsiIPO11.
HGNCiHGNC:20628. IPO11.
MIMi610889. gene.
neXtProtiNX_Q9UI26.
PharmGKBiPA134936197.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1993. Eukaryota.
COG5657. LUCA.
GeneTreeiENSGT00390000014071.
HOGENOMiHOG000008140.
HOVERGENiHBG061387.
InParanoidiQ9UI26.
OMAiLLLIRAC.
PhylomeDBiQ9UI26.
TreeFamiTF324336.

Miscellaneous databases

ChiTaRSiIPO11. human.
GeneWikiiIPO11.
GenomeRNAii51194.
NextBioi54202.
PROiQ9UI26.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UI26.
CleanExiHS_IPO11.
ExpressionAtlasiQ9UI26. baseline and differential.
GenevisibleiQ9UI26. HS.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR001494. Importin-beta_N.
[Graphical view]
PfamiPF03810. IBN_N. 1 hit.
[Graphical view]
SMARTiSM00913. IBN_N. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50166. IMPORTIN_B_NT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Human RanBP11."
    Goerlich D., Prehn S., Hartmann E.
    Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Cervix and Testis.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 816-975 (ISOFORMS 1/2).
    Tissue: Testis.
  7. "Importin-11, a nuclear import receptor for the ubiquitin-conjugating enzyme, UbcM2."
    Plafker S.M., Macara I.G.
    EMBO J. 19:5502-5513(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH UBE2E3.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiIPO11_HUMAN
AccessioniPrimary (citable) accession number: Q9UI26
Secondary accession number(s): A6NGJ5
, B4DZ73, D3DW98, Q8N5R2, Q9NSJ6, Q9NVB1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: May 1, 2000
Last modified: May 11, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.