Q9UI26 (IPO11_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Importin-11 Short name=Imp11 Alternative name(s): Ran-binding protein 11 Short name=RanBP11 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 975 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus By similarity. Mediates the nuclear import of UBE2E3, and of RPL12 By similarity. Ref.7 |
| Subunit structure | Interacts with UBE2E3 and RPL12. Ref.7 |
| Subcellular location | |
| Sequence similarities | Belongs to the importin beta family. Contains 15 HEAT repeats. Contains 1 importin N-terminal domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat |
| PTM | Acetylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UI26-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UI26-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVQPIIHLGYVVYSLLYLGYKPVQHVTALNTVSSCHKMVSM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 975 | 975 | Importin-11 | PRO_0000120756 | |||||
Regions | |||||||||
| Domain | 28 – 100 | 73 | Importin N-terminal | ||||||
| Repeat | 123 – 160 | 38 | HEAT 1 | ||||||
| Repeat | 209 – 248 | 40 | HEAT 2 | ||||||
| Repeat | 318 – 356 | 39 | HEAT 3 | ||||||
| Repeat | 422 – 459 | 38 | HEAT 4 | ||||||
| Repeat | 473 – 509 | 37 | HEAT 5 | ||||||
| Repeat | 511 – 548 | 38 | HEAT 6 | ||||||
| Repeat | 555 – 593 | 39 | HEAT 7 | ||||||
| Repeat | 600 – 636 | 37 | HEAT 8 | ||||||
| Repeat | 640 – 677 | 38 | HEAT 9 | ||||||
| Repeat | 683 – 720 | 38 | HEAT 10 | ||||||
| Repeat | 743 – 764 | 22 | HEAT 11 | ||||||
| Repeat | 765 – 804 | 40 | HEAT 12 | ||||||
| Repeat | 819 – 849 | 31 | HEAT 13 | ||||||
| Repeat | 850 – 887 | 38 | HEAT 14 | ||||||
| Repeat | 957 – 974 | 18 | HEAT 15 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MVQPIIHLGYVVYSLLYLGY KPVQHVTALNTVSSCHKMVS M in isoform 2. | VSP_041420 | |||||
| Natural variant | 260 | 1 | N → D. Corresponds to variant rs35107530 [ dbSNP | Ensembl ]. | VAR_050004 | |||||
| Natural variant | 937 | 1 | I → V. Corresponds to variant rs11544795 [ dbSNP | Ensembl ]. | VAR_050005 | |||||
Experimental info | |||||||||
| Sequence conflict | 53 | 1 | T → A in BAG63985. Ref.2 | ||||||
| Sequence conflict | 204 | 1 | I → T in BAA91843. Ref.2 | ||||||
| Sequence conflict | 237 | 1 | G → V in BAG63985. Ref.2 | ||||||
| Sequence conflict | 332 | 1 | A → T in BAG63985. Ref.2 | ||||||
| Sequence conflict | 504 | 1 | I → V in BAA91843. Ref.2 | ||||||
| Sequence conflict | 571 | 1 | V → A in BAA91843. Ref.2 | ||||||
| Sequence conflict | 722 | 1 | L → S in BAG63985. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human RanBP11." Goerlich D., Prehn S., Hartmann E. Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed: 15372022] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cervix and Testis. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 816-975 (ISOFORMS 1/2). Tissue: Testis. |
| [7] | "Importin-11, a nuclear import receptor for the ubiquitin-conjugating enzyme, UbcM2." Plafker S.M., Macara I.G. EMBO J. 19:5502-5513(2000) [PubMed: 11032817] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH UBE2E3. |
| [8] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF111109 mRNA. Translation: AAF21936.1. AK302781 mRNA. Translation: BAG63985.1. AK001696 mRNA. Translation: BAA91843.1. AC008859 Genomic DNA. No translation available. CH471137 Genomic DNA. Translation: EAW51379.1. CH471137 Genomic DNA. Translation: EAW51380.1. BC031694 mRNA. Translation: AAH31694.1. BC033776 mRNA. Translation: AAH33776.1. AL162083 mRNA. Translation: CAB82416.1. |
| IPI | IPI00301107. IPI00913938. |
| PIR | T47185. |
| RefSeq | NP_001128251.1. NM_001134779.1. NP_057422.3. NM_016338.4. |
| UniGene | Hs.482269. |
3D structure databases | |
| ProteinModelPortal | Q9UI26. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UI26. 2 interactions. |
| MINT | MINT-1460740. |
| STRING | Q9UI26. |
PTM databases | |
| PhosphoSite | Q9UI26. |
Polymorphism databases | |
| DMDM | 50401199. |
Proteomic databases | |
| PeptideAtlas | Q9UI26. |
| PRIDE | Q9UI26. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000325324; ENSP00000316651; ENSG00000086200. ENST00000409296; ENSP00000386992; ENSG00000086200. |
| GeneID | 51194. |
| KEGG | hsa:51194. |
| UCSC | uc003jtc.1. human. |
Organism-specific databases | |
| CTD | 51194. |
| GeneCards | GC05P061744. |
| HGNC | HGNC:20628. IPO11. |
| MIM | 610889. gene. |
| neXtProt | NX_Q9UI26. |
| PharmGKB | PA134936197. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG13372. |
| GeneTree | ENSGT00390000014071. |
| HOVERGEN | HBG061387. |
| InParanoid | Q9UI26. |
| PhylomeDB | Q9UI26. |
Gene expression databases | |
| ArrayExpress | Q9UI26. |
| Bgee | Q9UI26. |
| CleanEx | HS_IPO11. |
| Genevestigator | Q9UI26. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR001494. Importin-beta_N. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 2 hits. |
| Pfam | PF03810. IBN_N. 1 hit. [Graphical view] |
| SMART | SM00913. IBN_N. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS50077. HEAT_REPEAT. False negative. PS50166. IMPORTIN_B_NT. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 54202. |
| SOURCE | Search... |
Entry information
| Entry name | IPO11_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UI26 Secondary accession number(s): A6NGJ5 Q9NVB1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with