Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Translation initiation factor eIF-2B subunit delta

Gene

EIF2B4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

GO - Molecular functioni

GO - Biological processi

  • cellular response to stimulus Source: UniProtKB
  • myelination Source: UniProtKB
  • negative regulation of translational initiation Source: GO_Central
  • negative regulation of translational initiation in response to stress Source: UniProtKB
  • oligodendrocyte development Source: UniProtKB
  • ovarian follicle development Source: UniProtKB
  • positive regulation of GTPase activity Source: GOC
  • regulation of translation Source: UniProtKB
  • response to glucose Source: UniProtKB
  • response to heat Source: UniProtKB
  • response to peptide hormone Source: UniProtKB
  • translational initiation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Initiation factor

Keywords - Biological processi

Protein biosynthesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000115211-MONOMER.
ReactomeiR-HSA-72731. Recycling of eIF2:GDP.
SIGNORiQ9UI10.

Names & Taxonomyi

Protein namesi
Recommended name:
Translation initiation factor eIF-2B subunit delta
Alternative name(s):
eIF-2B GDP-GTP exchange factor subunit delta
Gene namesi
Name:EIF2B4
Synonyms:EIF2BD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:3260. EIF2B4.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • eukaryotic translation initiation factor 2B complex Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

Leukodystrophy with vanishing white matter (VWM)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy.
See also OMIM:603896
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_068455209R → Q in VWM. 1 PublicationCorresponds to variant rs113994028dbSNPEnsembl.1
Natural variantiVAR_015405228A → V in VWM. 1 PublicationCorresponds to variant rs113994027dbSNPEnsembl.1
Natural variantiVAR_068456269L → R in VWM. 1 PublicationCorresponds to variant rs113994031dbSNPEnsembl.1
Natural variantiVAR_015407357R → Q in VWM. 1 PublicationCorresponds to variant rs113994033dbSNPEnsembl.1
Natural variantiVAR_015408374R → C in VWM. 2 PublicationsCorresponds to variant rs113994035dbSNPEnsembl.1
Natural variantiVAR_016843465C → R in VWM; with ovarian failure. 1 PublicationCorresponds to variant rs113994038dbSNPEnsembl.1
Natural variantiVAR_016844489Y → H in VWM; with ovarian failure. 1 PublicationCorresponds to variant rs113994040dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation, Leukodystrophy

Organism-specific databases

DisGeNETi8890.
MalaCardsiEIF2B4.
MIMi603896. phenotype.
OpenTargetsiENSG00000115211.
Orphaneti157713. Congenital or early infantile CACH syndrome.
99854. Cree leukoencephalopathy.
157719. Juvenile or adult CACH syndrome.
157716. Late infantile CACH syndrome.
99853. Ovarioleukodystrophy.
PharmGKBiPA27691.

Polymorphism and mutation databases

BioMutaiEIF2B4.
DMDMi28381357.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001560672 – 523Translation initiation factor eIF-2B subunit deltaAdd BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei12PhosphoserineCombined sources1
Modified residuei86PhosphothreonineCombined sources1
Modified residuei130PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9UI10.
PaxDbiQ9UI10.
PeptideAtlasiQ9UI10.
PRIDEiQ9UI10.

PTM databases

iPTMnetiQ9UI10.
PhosphoSitePlusiQ9UI10.

Expressioni

Gene expression databases

BgeeiENSG00000115211.
CleanExiHS_EIF2B4.
ExpressionAtlasiQ9UI10. baseline and differential.
GenevisibleiQ9UI10. HS.

Organism-specific databases

HPAiCAB032234.
HPA039993.

Interactioni

Subunit structurei

Complex of five different subunits; alpha, beta, gamma, delta and epsilon.

Binary interactionsi

WithEntry#Exp.IntActNotes
EIF2B2Q53XC24EBI-2340132,EBI-10288660

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114407. 41 interactors.
IntActiQ9UI10. 18 interactors.
MINTiMINT-4990902.
STRINGi9606.ENSP00000394869.

Structurei

3D structure databases

ProteinModelPortaliQ9UI10.
SMRiQ9UI10.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1467. Eukaryota.
COG1184. LUCA.
GeneTreeiENSGT00550000075009.
HOGENOMiHOG000176924.
HOVERGENiHBG051459.
InParanoidiQ9UI10.
KOiK03680.
PhylomeDBiQ9UI10.
TreeFamiTF101508.

Family and domain databases

InterProiIPR000649. IF-2B-related.
[Graphical view]
PfamiPF01008. IF-2B. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UI10-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVAVAVRE DSGSGMKAEL PPGPGAVGRE MTKEEKLQLR KEKKQQKKKR
60 70 80 90 100
KEEKGAEPET GSAVSAAQCQ VGPTRELPES GIQLGTPREK VPAGRSKAEL
110 120 130 140 150
RAERRAKQEA ERALKQARKG EQGGPPPKAS PSTAGETPSG VKRLPEYPQV
160 170 180 190 200
DDLLLRRLVK KPERQQVPTR KDYGSKVSLF SHLPQYSRQN SLTQFMSIPS
210 220 230 240 250
SVIHPAMVRL GLQYSQGLVS GSNARCIALL RALQQVIQDY TTPPNEELSR
260 270 280 290 300
DLVNKLKPYM SFLTQCRPLS ASMHNAIKFL NKEITSVGSS KREEEAKSEL
310 320 330 340 350
RAAIDRYVQE KIVLAAQAIS RFAYQKISNG DVILVYGCSS LVSRILQEAW
360 370 380 390 400
TEGRRFRVVV VDSRPWLEGR HTLRSLVHAG VPASYLLIPA ASYVLPEVSK
410 420 430 440 450
VLLGAHALLA NGSVMSRVGT AQLALVARAH NVPVLVCCET YKFCERVQTD
460 470 480 490 500
AFVSNELDDP DDLQCKRGEH VALANWQNHA SLRLLNLVYD VTPPELVDLV
510 520
ITELGMIPCS SVPVVLRVKS SDQ
Length:523
Mass (Da):57,557
Last modified:February 12, 2003 - v2
Checksum:i5F38CF10CAD5A45E
GO
Isoform 2 (identifier: Q9UI10-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MAAVAVAVRE → MPTQQPAAPSTRAPKPSRSLSGSLCALFSDA
     71-71: Missing.

Show »
Length:543
Mass (Da):59,615
Checksum:iC65253AD9431E074
GO
Isoform 3 (identifier: Q9UI10-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-71: Missing.

Show »
Length:522
Mass (Da):57,458
Checksum:iD9A7E6FD35CD75F1
GO

Sequence cautioni

The sequence CAB57305 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti197S → T in CAB57260 (Ref. 2) Curated1
Sequence conflicti197S → T in CAB57261 (Ref. 2) Curated1
Sequence conflicti197S → T in CAB57304 (Ref. 2) Curated1
Sequence conflicti197S → T in CAB57305 (Ref. 2) Curated1
Sequence conflicti323A → S in AAF17195 (PubMed:10931946).Curated1
Sequence conflicti481S → L in AAF17195 (PubMed:10931946).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04891893A → V.Corresponds to variant rs34155621dbSNPEnsembl.1
Natural variantiVAR_068455209R → Q in VWM. 1 PublicationCorresponds to variant rs113994028dbSNPEnsembl.1
Natural variantiVAR_015405228A → V in VWM. 1 PublicationCorresponds to variant rs113994027dbSNPEnsembl.1
Natural variantiVAR_068456269L → R in VWM. 1 PublicationCorresponds to variant rs113994031dbSNPEnsembl.1
Natural variantiVAR_015406306R → G.1 PublicationCorresponds to variant rs78599355dbSNPEnsembl.1
Natural variantiVAR_015407357R → Q in VWM. 1 PublicationCorresponds to variant rs113994033dbSNPEnsembl.1
Natural variantiVAR_015408374R → C in VWM. 2 PublicationsCorresponds to variant rs113994035dbSNPEnsembl.1
Natural variantiVAR_016843465C → R in VWM; with ovarian failure. 1 PublicationCorresponds to variant rs113994038dbSNPEnsembl.1
Natural variantiVAR_016844489Y → H in VWM; with ovarian failure. 1 PublicationCorresponds to variant rs113994040dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0014331 – 10MAAVAVAVRE → MPTQQPAAPSTRAPKPSRSL SGSLCALFSDA in isoform 2. 1 Publication10
Alternative sequenceiVSP_04013071Missing in isoform 2 and isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF112207 mRNA. Translation: AAF17195.1.
AJ011305 mRNA. Translation: CAB57260.1.
AJ011306 mRNA. Translation: CAB57261.1.
AJ011307, AJ011308 Genomic DNA. Translation: CAB57304.1.
AJ011307, AJ011308 Genomic DNA. Translation: CAB57305.1. Sequence problems.
AC074117 Genomic DNA. Translation: AAY14843.1.
CH471053 Genomic DNA. Translation: EAX00591.1.
BC001870 mRNA. Translation: AAH01870.1.
BC091502 mRNA. Translation: AAH91502.1.
CCDSiCCDS33164.1. [Q9UI10-1]
CCDS46244.1. [Q9UI10-3]
CCDS46245.1. [Q9UI10-2]
RefSeqiNP_001029288.1. NM_001034116.1. [Q9UI10-1]
NP_001305894.1. NM_001318965.1.
NP_001305895.1. NM_001318966.1.
NP_001305896.1. NM_001318967.1.
NP_001305897.1. NM_001318968.1.
NP_056451.3. NM_015636.3. [Q9UI10-3]
NP_751945.2. NM_172195.3. [Q9UI10-2]
UniGeneiHs.169474.

Genome annotation databases

EnsembliENST00000347454; ENSP00000233552; ENSG00000115211. [Q9UI10-1]
ENST00000445933; ENSP00000394397; ENSG00000115211. [Q9UI10-3]
ENST00000451130; ENSP00000394869; ENSG00000115211. [Q9UI10-2]
GeneIDi8890.
KEGGihsa:8890.
UCSCiuc002rjz.4. human. [Q9UI10-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Mendelian genes eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa (EIF2B4)

Leiden Open Variation Database (LOVD)

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF112207 mRNA. Translation: AAF17195.1.
AJ011305 mRNA. Translation: CAB57260.1.
AJ011306 mRNA. Translation: CAB57261.1.
AJ011307, AJ011308 Genomic DNA. Translation: CAB57304.1.
AJ011307, AJ011308 Genomic DNA. Translation: CAB57305.1. Sequence problems.
AC074117 Genomic DNA. Translation: AAY14843.1.
CH471053 Genomic DNA. Translation: EAX00591.1.
BC001870 mRNA. Translation: AAH01870.1.
BC091502 mRNA. Translation: AAH91502.1.
CCDSiCCDS33164.1. [Q9UI10-1]
CCDS46244.1. [Q9UI10-3]
CCDS46245.1. [Q9UI10-2]
RefSeqiNP_001029288.1. NM_001034116.1. [Q9UI10-1]
NP_001305894.1. NM_001318965.1.
NP_001305895.1. NM_001318966.1.
NP_001305896.1. NM_001318967.1.
NP_001305897.1. NM_001318968.1.
NP_056451.3. NM_015636.3. [Q9UI10-3]
NP_751945.2. NM_172195.3. [Q9UI10-2]
UniGeneiHs.169474.

3D structure databases

ProteinModelPortaliQ9UI10.
SMRiQ9UI10.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114407. 41 interactors.
IntActiQ9UI10. 18 interactors.
MINTiMINT-4990902.
STRINGi9606.ENSP00000394869.

PTM databases

iPTMnetiQ9UI10.
PhosphoSitePlusiQ9UI10.

Polymorphism and mutation databases

BioMutaiEIF2B4.
DMDMi28381357.

Proteomic databases

EPDiQ9UI10.
PaxDbiQ9UI10.
PeptideAtlasiQ9UI10.
PRIDEiQ9UI10.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000347454; ENSP00000233552; ENSG00000115211. [Q9UI10-1]
ENST00000445933; ENSP00000394397; ENSG00000115211. [Q9UI10-3]
ENST00000451130; ENSP00000394869; ENSG00000115211. [Q9UI10-2]
GeneIDi8890.
KEGGihsa:8890.
UCSCiuc002rjz.4. human. [Q9UI10-1]

Organism-specific databases

CTDi8890.
DisGeNETi8890.
GeneCardsiEIF2B4.
GeneReviewsiEIF2B4.
HGNCiHGNC:3260. EIF2B4.
HPAiCAB032234.
HPA039993.
MalaCardsiEIF2B4.
MIMi603896. phenotype.
606687. gene.
neXtProtiNX_Q9UI10.
OpenTargetsiENSG00000115211.
Orphaneti157713. Congenital or early infantile CACH syndrome.
99854. Cree leukoencephalopathy.
157719. Juvenile or adult CACH syndrome.
157716. Late infantile CACH syndrome.
99853. Ovarioleukodystrophy.
PharmGKBiPA27691.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1467. Eukaryota.
COG1184. LUCA.
GeneTreeiENSGT00550000075009.
HOGENOMiHOG000176924.
HOVERGENiHBG051459.
InParanoidiQ9UI10.
KOiK03680.
PhylomeDBiQ9UI10.
TreeFamiTF101508.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000115211-MONOMER.
ReactomeiR-HSA-72731. Recycling of eIF2:GDP.
SIGNORiQ9UI10.

Miscellaneous databases

GeneWikiiEIF2B4.
GenomeRNAii8890.
PROiQ9UI10.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115211.
CleanExiHS_EIF2B4.
ExpressionAtlasiQ9UI10. baseline and differential.
GenevisibleiQ9UI10. HS.

Family and domain databases

InterProiIPR000649. IF-2B-related.
[Graphical view]
PfamiPF01008. IF-2B. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEI2BD_HUMAN
AccessioniPrimary (citable) accession number: Q9UI10
Secondary accession number(s): Q53RY7
, Q5BJF4, Q9BUV9, Q9UBG4, Q9UIQ9, Q9UJ95
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: February 12, 2003
Last modified: November 30, 2016
This is version 150 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.