Q9UI10 (EI2BD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 113.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Translation initiation factor eIF-2B subunit delta Alternative name(s): eIF-2B GDP-GTP exchange factor subunit delta | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 523 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. |
| Subunit structure | Complex of five different subunits; alpha, beta, gamma, delta and epsilon. |
| Involvement in disease | Leukodystrophy with vanishing white matter (VWM) [MIM:603896]: A leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy. |
| Sequence similarities | Belongs to the eIF-2B alpha/beta/delta subunits family. |
| Sequence caution | The sequence CAB57305.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UI10-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UI10-2) The sequence of this isoform differs from the canonical sequence as follows: 1-10: MAAVAVAVRE → MPTQQPAAPSTRAPKPSRSLSGSLCALFSDA 71-71: Missing. | ||||||
| Isoform 3 (identifier: Q9UI10-3) The sequence of this isoform differs from the canonical sequence as follows: 71-71: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 523 | 523 | Translation initiation factor eIF-2B subunit delta | PRO_0000156067 | |||||
Amino acid modifications | |||||||||
| Modified residue | 86 | 1 | Phosphothreonine Ref.7 Ref.8 Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 10 | 10 | MAAVAVAVRE → MPTQQPAAPSTRAPKPSRSL SGSLCALFSDA in isoform 2. | VSP_001433 | |||||
| Alternative sequence | 71 | 1 | Missing in isoform 2 and isoform 3. | VSP_040130 | |||||
| Natural variant | 93 | 1 | A → V. Corresponds to variant rs34155621 [ dbSNP | Ensembl ]. | VAR_048918 | |||||
| Natural variant | 209 | 1 | R → Q in VWM. Ref.13 | VAR_068455 | |||||
| Natural variant | 228 | 1 | A → V in VWM. Ref.11 | VAR_015405 | |||||
| Natural variant | 269 | 1 | L → R in VWM. Ref.13 | VAR_068456 | |||||
| Natural variant | 306 | 1 | R → G. Ref.11 | VAR_015406 | |||||
| Natural variant | 357 | 1 | R → Q in VWM. Ref.11 | VAR_015407 | |||||
| Natural variant | 374 | 1 | R → C in VWM. Ref.11 Ref.13 | VAR_015408 | |||||
| Natural variant | 465 | 1 | C → R in VWM; with ovarian failure. Ref.12 | VAR_016843 | |||||
| Natural variant | 489 | 1 | Y → H in VWM; with ovarian failure. Ref.12 | VAR_016844 | |||||
Experimental info | |||||||||
| Sequence conflict | 197 | 1 | S → T in CAB57260. Ref.2 | ||||||
| Sequence conflict | 197 | 1 | S → T in CAB57261. Ref.2 | ||||||
| Sequence conflict | 197 | 1 | S → T in CAB57304. Ref.2 | ||||||
| Sequence conflict | 197 | 1 | S → T in CAB57305. Ref.2 | ||||||
| Sequence conflict | 323 | 1 | A → S in AAF17195. Ref.1 | ||||||
| Sequence conflict | 481 | 1 | S → L in AAF17195. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Adrenal gland. |
| [2] | "cDNA cloning, genomic organization and chromosomal localization of the human eIF2B delta subunit." Wightman P.J., Bonthron D.T. Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3). |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Testis. |
| [6] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-86, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-86, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-86, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [11] | "Mutations in each of the five subunits of translation initiation factor eIF2B can cause leukoencephalopathy with vanishing white matter." van der Knaap M.S., Leegwater P.A.J., Koenst A.A.M., Visser A., Naidu S., Oudejans C.B.M., Schutgens R.B.H., Pronk J.C. Ann. Neurol. 51:264-270(2002) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS VWM VAL-228; GLN-357 AND CYS-374, VARIANT GLY-306. |
| [12] | "Ovarian failure related to eukaryotic initiation factor 2B mutations." Fogli A., Rodriguez D., Eymard-Pierre E., Bouhour F., Labauge P., Meaney B.F., Zeesman S., Kaneski C.R., Schiffmann R., Boespflug-Tanguy O. Am. J. Hum. Genet. 72:1544-1550(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS VWM ARG-465 AND HIS-489. |
| [13] | "Identification of ten novel mutations in patients with eIF2B-related disorders." Ohlenbusch A., Henneke M., Brockmann K., Goerg M., Hanefeld F., Kohlschutter A., Gartner J. Hum. Mutat. 25:411-411(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS VWM GLN-209; ARG-269 AND CYS-374. |
| + | Additional computationally mapped references. |
Web resources
| GeneReviews |
| Mendelian genes eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa (EIF2B4) Leiden Open Variation Database (LOVD) |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF112207 mRNA. Translation: AAF17195.1. AJ011305 mRNA. Translation: CAB57260.1. AJ011306 mRNA. Translation: CAB57261.1. AJ011307, AJ011308 Genomic DNA. Translation: CAB57304.1. AJ011307, AJ011308 Genomic DNA. Translation: CAB57305.1. Sequence problems. AC074117 Genomic DNA. Translation: AAY14843.1. CH471053 Genomic DNA. Translation: EAX00591.1. BC001870 mRNA. Translation: AAH01870.1. BC091502 mRNA. Translation: AAH91502.1. |
| IPI | IPI00005979. IPI00220232. IPI00654843. |
| RefSeq | NP_001029288.1. NM_001034116.1. NP_056451.3. NM_015636.3. NP_751945.2. NM_172195.3. |
| UniGene | Hs.169474. |
3D structure databases | |
| ProteinModelPortal | Q9UI10. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UI10. 4 interactions. |
| STRING | 9606.ENSP00000394869. |
PTM databases | |
| PhosphoSite | Q9UI10. |
Polymorphism databases | |
| DMDM | 28381357. |
Proteomic databases | |
| PaxDb | Q9UI10. |
| PRIDE | Q9UI10. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000347454; ENSP00000233552; ENSG00000115211. ENST00000445933; ENSP00000394397; ENSG00000115211. ENST00000451130; ENSP00000394869; ENSG00000115211. |
| GeneID | 8890. |
| KEGG | hsa:8890. |
| UCSC | uc002rjz.3. human. uc002rka.3. human. uc002rkc.3. human. |
Organism-specific databases | |
| CTD | 8890. |
| GeneCards | GC02M027587. |
| HGNC | HGNC:3260. EIF2B4. |
| HPA | CAB032234. |
| MIM | 603896. phenotype. 606687. gene. |
| neXtProt | NX_Q9UI10. |
| Orphanet | 99854. Cree leukoencephalopathy. 157716. Late infantile CACH syndrome. 99853. Ovarioleukodystrophy. |
| PharmGKB | PA27691. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1184. |
| HOGENOM | HOG000176924. |
| HOVERGEN | HBG051459. |
| InParanoid | Q9UI10. |
| KO | K03680. |
Enzyme and pathway databases | |
| Reactome | REACT_17015. Metabolism of proteins. REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | Q9UI10. |
| Bgee | Q9UI10. |
| CleanEx | HS_EIF2B4. |
| Genevestigator | Q9UI10. |
| GermOnline | ENSG00000115211. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000649. IF-2B-related. [Graphical view] |
| PANTHER | PTHR10233. PTHR10233. 1 hit. |
| Pfam | PF01008. IF-2B. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 8890. |
| NextBio | 33383. |
| SOURCE | Search... |
Entry information
| Entry name | EI2BD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UI10 Secondary accession number(s): Q53RY7 Q9UJ95 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
