Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ena/VASP-like protein

Gene

EVL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. EVL enhances actin nucleation and polymerization.

GO - Molecular functioni

GO - Biological processi

  • actin filament organization Source: ProtInc
  • actin polymerization or depolymerization Source: UniProtKB
  • animal organ morphogenesis Source: UniProtKB
  • axon guidance Source: Reactome
  • cell surface receptor signaling pathway Source: UniProtKB
  • negative regulation of epithelial cell migration Source: UniProtKB
  • negative regulation of ruffle assembly Source: UniProtKB
  • nervous system development Source: UniProtKB
  • positive regulation of actin filament polymerization Source: Ensembl
  • positive regulation of stress fiber assembly Source: UniProtKB
  • protein homotetramerization Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:G66-30893-MONOMER.
ReactomeiR-HSA-202433. Generation of second messenger molecules.
R-HSA-376176. Signaling by Robo receptor.
R-HSA-5663220. RHO GTPases Activate Formins.
SignaLinkiQ9UI08.

Names & Taxonomyi

Protein namesi
Recommended name:
Ena/VASP-like protein
Alternative name(s):
Ena/vasodilator-stimulated phosphoprotein-like
Gene namesi
Name:EVL
Synonyms:RNB6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:20234. EVL.

Subcellular locationi

  • Cytoplasmcytoskeleton By similarity
  • Cell projectionlamellipodium By similarity

  • Note: Targeted to the leading edge of lamellipodia and the dital tip of stress fibers through interaction with a number of proteins. In activated T-cells, localizes to the F-actin collar and the distal tip of microspikes (By similarity).By similarity

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytoskeleton Source: UniProtKB-SubCell
  • cytosol Source: Reactome
  • focal adhesion Source: UniProtKB
  • lamellipodium Source: UniProtKB
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi51466.
OpenTargetsiENSG00000196405.
PharmGKBiPA134890866.

Polymorphism and mutation databases

BioMutaiEVL.
DMDMi25090276.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000871041 – 416Ena/VASP-like proteinAdd BLAST416

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei130PhosphoserineBy similarity1
Modified residuei246PhosphoserineCombined sources1
Modified residuei259PhosphoserineBy similarity1
Modified residuei304PhosphoserineCombined sources1
Modified residuei306PhosphoserineCombined sources1
Modified residuei329PhosphoserineCombined sources1
Modified residuei331PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei349PhosphoserineCombined sources1
Modified residuei354PhosphoserineCombined sources1
Modified residuei369PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by PKA; phosphorylation abolishes binding to SH3 domains of ABL and SRC.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UI08.
PaxDbiQ9UI08.
PeptideAtlasiQ9UI08.
PRIDEiQ9UI08.

PTM databases

iPTMnetiQ9UI08.
PhosphoSitePlusiQ9UI08.

Expressioni

Gene expression databases

BgeeiENSG00000196405.
CleanExiHS_EVL.
ExpressionAtlasiQ9UI08. baseline and differential.
GenevisibleiQ9UI08. HS.

Organism-specific databases

HPAiCAB033987.
HPA018849.

Interactioni

Subunit structurei

Homotetramer (By similarity). Binds to the SH3 domains of ABL1, LYN and SRC. Also binds to profilin, with preference for isoform IIa of PFN2, and the WW domain of APBB1/FE65. Binds to SEMA6A. Interacts, via the Pro-rich region, with the C-terminal SH3 domain of DNMBP. Interacts with RAPH1. Binds, via the EVH1 domain, the Pro-rich domain of Listeria monocytogenes actA (By similarity). Binds, via the EVH1 domain, the Pro-rich domain of ZYX.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ABI3Q9P2A43EBI-346653,EBI-742038
HTTP428582EBI-6448852,EBI-466029
SPTAN1Q138134EBI-346653,EBI-351450
TRIM9Q9C0263EBI-346653,EBI-720828
ZDHHC17Q8IUH52EBI-6448852,EBI-524753

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119556. 41 interactors.
IntActiQ9UI08. 16 interactors.
MINTiMINT-3080348.
STRINGi9606.ENSP00000376652.

Structurei

3D structure databases

ProteinModelPortaliQ9UI08.
SMRiQ9UI08.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 112WH1PROSITE-ProRule annotationAdd BLAST112

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni222 – 413EVH2Add BLAST192
Regioni222 – 242EVH2 block AAdd BLAST21
Regioni265 – 282EVH2 block BAdd BLAST18
Regioni379 – 413EVH2 block CAdd BLAST35

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi231 – 234KLKR4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi162 – 206Pro-richAdd BLAST45

Domaini

The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.

Sequence similaritiesi

Belongs to the Ena/VASP family.Curated
Contains 1 WH1 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiENOG410IQ1Z. Eukaryota.
ENOG410YM7V. LUCA.
GeneTreeiENSGT00730000110272.
HOGENOMiHOG000013015.
HOVERGENiHBG006655.
InParanoidiQ9UI08.
OMAiQHRQESL.
OrthoDBiEOG091G0QTE.
PhylomeDBiQ9UI08.
TreeFamiTF321411.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR017354. Vasodilator_phosphoprotein.
IPR014885. VASP_tetra.
IPR000697. WH1/EVH1_dom.
[Graphical view]
PfamiPF08776. VASP_tetra. 1 hit.
PF00568. WH1. 1 hit.
[Graphical view]
PIRSFiPIRSF038010. Vasodilator_Phospo. 1 hit.
SMARTiSM00461. WH1. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS50229. WH1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q9UI08-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQSICQAR ASVMVYDDTS KKWVPIKPGQ QGFSRINIYH NTASNTFRVV
60 70 80 90 100
GVKLQDQQVV INYSIVKGLK YNQATPTFHQ WRDARQVYGL NFASKEEATT
110 120 130 140 150
FSNAMLFALN IMNSQEGGPS SQRQVQNGPS PDEMDIQRRQ VMEQHQQQRQ
160 170 180 190 200
ESLERRTSAT GPILPPGHPS SAASAPVSCS GPPPPPPPPV PPPPTGATPP
210 220 230 240 250
PPPPLPAGGA QGSSHDESSM SGLAAAIAGA KLRRVQRPED ASGGSSPSGT
260 270 280 290 300
SKSDANRASS GGGGGGLMEE MNKLLAKRRK AASQSDKPAE KKEDESQMED
310 320 330 340 350
PSTSPSPGTR AASQPPNSSE AGRKPWERSN SVEKPVSSIL SRTPSVAKSP
360 370 380 390 400
EAKSPLQSQP HSRMKPAGSV NDMALDAFDL DRMKQEILEE VVRELHKVKE
410
EIIDAIRQEL SGISTT
Length:416
Mass (Da):44,620
Last modified:November 15, 2002 - v2
Checksum:iAD5B67458755D659
GO
Isoform 1 (identifier: Q9UI08-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAT

Show »
Length:418
Mass (Da):44,792
Checksum:iBFCCF68CF923720C
GO
Isoform 3 (identifier: Q9UI08-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFAFEEF
     364-416: MKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT → YRTTLLLTCPPGFGAPLSPVP

Note: No experimental confirmation available.
Show »
Length:390
Mass (Da):41,577
Checksum:iF2E44B1B78751A0F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti201P → S in AAF17197 (PubMed:10931946).Curated1
Sequence conflicti329S → N in AAP97156 (Ref. 2) Curated1
Sequence conflicti364M → Y in CAB63763 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036464188P → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant rs367737727dbSNPEnsembl.1
Natural variantiVAR_036465247P → L in a colorectal cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0040441M → MAT in isoform 1. 3 Publications1
Alternative sequenceiVSP_0573221M → MFAFEEF in isoform 3. 1 Publication1
Alternative sequenceiVSP_057323364 – 416MKPAG…GISTT → YRTTLLLTCPPGFGAPLSPV P in isoform 3. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052504 mRNA. Translation: AAF21709.1.
AF087843 mRNA. Translation: AAP97156.1.
AF112209 mRNA. Translation: AAF17197.1.
AK289720 mRNA. Translation: BAF82409.1.
AK295919 mRNA. Translation: BAH12221.1.
AL133368 Genomic DNA. No translation available.
AL133523 Genomic DNA. No translation available.
AL157912 Genomic DNA. No translation available.
KF456005 Genomic DNA. No translation available.
KF456007 Genomic DNA. No translation available.
KF456010 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW81684.1.
BC023997 mRNA. Translation: AAH23997.1.
BC032358 mRNA. Translation: AAH32358.1.
AF131766 mRNA. Translation: AAD20040.1.
AL133642 mRNA. Translation: CAB63763.2.
CCDSiCCDS81851.1. [Q9UI08-1]
CCDS9955.1. [Q9UI08-2]
RefSeqiNP_001317150.1. NM_001330221.1.
NP_057421.1. NM_016337.2. [Q9UI08-2]
UniGeneiHs.125867.

Genome annotation databases

EnsembliENST00000392920; ENSP00000376652; ENSG00000196405. [Q9UI08-2]
ENST00000402714; ENSP00000384720; ENSG00000196405. [Q9UI08-1]
ENST00000544450; ENSP00000437904; ENSG00000196405. [Q9UI08-3]
GeneIDi51466.
KEGGihsa:51466.
UCSCiuc001ygt.4. human. [Q9UI08-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF052504 mRNA. Translation: AAF21709.1.
AF087843 mRNA. Translation: AAP97156.1.
AF112209 mRNA. Translation: AAF17197.1.
AK289720 mRNA. Translation: BAF82409.1.
AK295919 mRNA. Translation: BAH12221.1.
AL133368 Genomic DNA. No translation available.
AL133523 Genomic DNA. No translation available.
AL157912 Genomic DNA. No translation available.
KF456005 Genomic DNA. No translation available.
KF456007 Genomic DNA. No translation available.
KF456010 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW81684.1.
BC023997 mRNA. Translation: AAH23997.1.
BC032358 mRNA. Translation: AAH32358.1.
AF131766 mRNA. Translation: AAD20040.1.
AL133642 mRNA. Translation: CAB63763.2.
CCDSiCCDS81851.1. [Q9UI08-1]
CCDS9955.1. [Q9UI08-2]
RefSeqiNP_001317150.1. NM_001330221.1.
NP_057421.1. NM_016337.2. [Q9UI08-2]
UniGeneiHs.125867.

3D structure databases

ProteinModelPortaliQ9UI08.
SMRiQ9UI08.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119556. 41 interactors.
IntActiQ9UI08. 16 interactors.
MINTiMINT-3080348.
STRINGi9606.ENSP00000376652.

PTM databases

iPTMnetiQ9UI08.
PhosphoSitePlusiQ9UI08.

Polymorphism and mutation databases

BioMutaiEVL.
DMDMi25090276.

Proteomic databases

EPDiQ9UI08.
PaxDbiQ9UI08.
PeptideAtlasiQ9UI08.
PRIDEiQ9UI08.

Protocols and materials databases

DNASUi51466.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392920; ENSP00000376652; ENSG00000196405. [Q9UI08-2]
ENST00000402714; ENSP00000384720; ENSG00000196405. [Q9UI08-1]
ENST00000544450; ENSP00000437904; ENSG00000196405. [Q9UI08-3]
GeneIDi51466.
KEGGihsa:51466.
UCSCiuc001ygt.4. human. [Q9UI08-1]

Organism-specific databases

CTDi51466.
DisGeNETi51466.
GeneCardsiEVL.
H-InvDBHIX0011964.
HGNCiHGNC:20234. EVL.
HPAiCAB033987.
HPA018849.
neXtProtiNX_Q9UI08.
OpenTargetsiENSG00000196405.
PharmGKBiPA134890866.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IQ1Z. Eukaryota.
ENOG410YM7V. LUCA.
GeneTreeiENSGT00730000110272.
HOGENOMiHOG000013015.
HOVERGENiHBG006655.
InParanoidiQ9UI08.
OMAiQHRQESL.
OrthoDBiEOG091G0QTE.
PhylomeDBiQ9UI08.
TreeFamiTF321411.

Enzyme and pathway databases

BioCyciZFISH:G66-30893-MONOMER.
ReactomeiR-HSA-202433. Generation of second messenger molecules.
R-HSA-376176. Signaling by Robo receptor.
R-HSA-5663220. RHO GTPases Activate Formins.
SignaLinkiQ9UI08.

Miscellaneous databases

ChiTaRSiEVL. human.
GeneWikiiEnah/Vasp-like.
GenomeRNAii51466.
PROiQ9UI08.

Gene expression databases

BgeeiENSG00000196405.
CleanExiHS_EVL.
ExpressionAtlasiQ9UI08. baseline and differential.
GenevisibleiQ9UI08. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR017354. Vasodilator_phosphoprotein.
IPR014885. VASP_tetra.
IPR000697. WH1/EVH1_dom.
[Graphical view]
PfamiPF08776. VASP_tetra. 1 hit.
PF00568. WH1. 1 hit.
[Graphical view]
PIRSFiPIRSF038010. Vasodilator_Phospo. 1 hit.
SMARTiSM00461. WH1. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS50229. WH1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEVL_HUMAN
AccessioniPrimary (citable) accession number: Q9UI08
Secondary accession number(s): A8K105
, B7Z3I5, O95884, Q7Z522, Q8TBV1, Q9UF25, Q9UIC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: November 15, 2002
Last modified: November 30, 2016
This is version 155 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Required to transform actin polymerization into active movement for the propulsive force of Listeria monocytogenes.By similarity

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.