Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GPN-loop GTPase 3

Gene

GPN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Small GTPase required for proper localization of RNA polymerase II (RNAPII). May act at an RNAP assembly step prior to nuclear import.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei74Stabilizes the phosphate intermediate; shared with dimeric partnerBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi13 – 18GTPBy similarity6
Nucleotide bindingi174 – 177GTPBy similarity4

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
GPN-loop GTPase 31 Publication
Alternative name(s):
ATP-binding domain 1 family member C
Gene namesi
Name:GPN31 PublicationImported
Synonyms:ATPBD1C
ORF Names:AD-009, UNQ1876/PRO4319
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:30186. GPN3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000111231.
PharmGKBiPA162390164.

Polymorphism and mutation databases

BioMutaiGPN3.
DMDMi158564000.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003047901 – 284GPN-loop GTPase 3Add BLAST284

Proteomic databases

EPDiQ9UHW5.
PaxDbiQ9UHW5.
PeptideAtlasiQ9UHW5.
PRIDEiQ9UHW5.

PTM databases

iPTMnetiQ9UHW5.
PhosphoSitePlusiQ9UHW5.

Expressioni

Gene expression databases

BgeeiENSG00000111231.
CleanExiHS_GPN3.
ExpressionAtlasiQ9UHW5. baseline and differential.
GenevisibleiQ9UHW5. HS.

Organism-specific databases

HPAiHPA039764.
HPA047793.

Interactioni

Subunit structurei

Heterodimer with GPN1 (PubMed:21768307). Binds to RNA polymerase II (RNAPII) (PubMed:20864038, PubMed:21768307). Interacts directly with subunits RPB4 and RPB7 and the CTD of RPB1 (PubMed:21768307).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
GPN1Q9HCN43EBI-395491,EBI-745137

Protein-protein interaction databases

BioGridi119359. 58 interactors.
IntActiQ9UHW5. 13 interactors.
MINTiMINT-4947564.
STRINGi9606.ENSP00000442770.

Structurei

3D structure databases

ProteinModelPortaliQ9UHW5.
SMRiQ9UHW5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi72 – 74Gly-Pro-Asn (GPN)-loop; involved in dimer interfaceBy similarity3

Sequence similaritiesi

Belongs to the GPN-loop GTPase family.Curated

Phylogenomic databases

eggNOGiKOG1534. Eukaryota.
ENOG410XPBZ. LUCA.
GeneTreeiENSGT00550000074942.
HOVERGENiHBG054729.
InParanoidiQ9UHW5.
KOiK06883.
OMAiYLDPDMY.
OrthoDBiEOG091G0EAS.
PhylomeDBiQ9UHW5.
TreeFamiTF105810.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR004130. Gpn.
IPR030228. Gpn3.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR21231. PTHR21231. 1 hit.
PTHR21231:SF7. PTHR21231:SF7. 1 hit.
PfamiPF03029. ATP_bind_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UHW5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPRYAQLVMG PAGSGKSTYC ATMVQHCEAL NRSVQVVNLD PAAEHFNYSV
60 70 80 90 100
MADIRELIEV DDVMEDDSLR FGPNGGLVFC MEYFANNFDW LENCLGHVED
110 120 130 140 150
DYILFDCPGQ IELYTHLPVM KQLVQQLEQW EFRVCGVFLV DSQFMVESFK
160 170 180 190 200
FISGILAALS AMISLEIPQV NIMTKMDLLS KKAKKEIEKF LDPDMYSLLE
210 220 230 240 250
DSTSDLRSKK FKKLTKAICG LIDDYSMVRF LPYDQSDEES MNIVLQHIDF
260 270 280
AIQYGEDLEF KEPKEREDES SSMFDEYFQE CQDE
Length:284
Mass (Da):32,761
Last modified:September 11, 2007 - v2
Checksum:i8E604ECB5C1DE3B5
GO
Isoform 2 (identifier: Q9UHW5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     15-15: G → GKVRICGDKER

Show »
Length:294
Mass (Da):33,947
Checksum:i7B8E6579A6265240
GO
Isoform 3 (identifier: Q9UHW5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MPRYAQLVMGPAGSGK → MLPKTRGAFHFSIPDPQHICKSRGSPYRSNVCTQTTDRSTWRKDAELYLLSVITQ

Note: Gene prediction based on EST data.
Show »
Length:323
Mass (Da):37,438
Checksum:i8DC788F0AB8490A4
GO

Sequence cautioni

The sequence CAD97937 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti6 – 7QL → HC in AAQ76821 (PubMed:16533400).Curated2
Sequence conflicti6 – 7QL → HC in AAF17210 (PubMed:10931946).Curated2
Sequence conflicti13 – 16GSGK → HAKR in AAQ76821 (PubMed:16533400).Curated4
Sequence conflicti13 – 16GSGK → HAKR in AAF17210 (PubMed:10931946).Curated4
Sequence conflicti122Q → H in AAQ89437 (PubMed:12975309).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03510752A → V.1 PublicationCorresponds to variant rs17856906dbSNPEnsembl.1
Natural variantiVAR_035108244V → A.1 PublicationCorresponds to variant rs17850320dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0473271 – 16MPRYA…AGSGK → MLPKTRGAFHFSIPDPQHIC KSRGSPYRSNVCTQTTDRST WRKDAELYLLSVITQ in isoform 3. CuratedAdd BLAST16
Alternative sequenceiVSP_02812515G → GKVRICGDKER in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY364262 mRNA. Translation: AAQ76821.1.
AM992619 mRNA. Translation: CAQ52399.1.
AM992620 mRNA. Translation: CAQ52400.1.
AF117229 mRNA. Translation: AAF17210.1.
AY359078 mRNA. Translation: AAQ89437.1.
BX537973 mRNA. Translation: CAD97937.1. Different initiation.
AK314946 mRNA. Translation: BAG37451.1.
AK223209 mRNA. Translation: BAD96929.1.
AC002350 Genomic DNA. No translation available.
AC144548 Genomic DNA. No translation available.
BC008416 mRNA. Translation: AAH08416.1.
BC031024 mRNA. Translation: AAH31024.1.
CCDSiCCDS53830.1. [Q9UHW5-2]
CCDS53831.1. [Q9UHW5-3]
CCDS9147.1. [Q9UHW5-1]
RefSeqiNP_001157844.1. NM_001164372.1. [Q9UHW5-3]
NP_001157845.1. NM_001164373.1. [Q9UHW5-2]
NP_057385.3. NM_016301.3. [Q9UHW5-1]
UniGeneiHs.634680.

Genome annotation databases

EnsembliENST00000228827; ENSP00000228827; ENSG00000111231. [Q9UHW5-1]
ENST00000537466; ENSP00000443068; ENSG00000111231. [Q9UHW5-2]
ENST00000543199; ENSP00000442770; ENSG00000111231. [Q9UHW5-3]
GeneIDi51184.
KEGGihsa:51184.
UCSCiuc001tqr.4. human. [Q9UHW5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY364262 mRNA. Translation: AAQ76821.1.
AM992619 mRNA. Translation: CAQ52399.1.
AM992620 mRNA. Translation: CAQ52400.1.
AF117229 mRNA. Translation: AAF17210.1.
AY359078 mRNA. Translation: AAQ89437.1.
BX537973 mRNA. Translation: CAD97937.1. Different initiation.
AK314946 mRNA. Translation: BAG37451.1.
AK223209 mRNA. Translation: BAD96929.1.
AC002350 Genomic DNA. No translation available.
AC144548 Genomic DNA. No translation available.
BC008416 mRNA. Translation: AAH08416.1.
BC031024 mRNA. Translation: AAH31024.1.
CCDSiCCDS53830.1. [Q9UHW5-2]
CCDS53831.1. [Q9UHW5-3]
CCDS9147.1. [Q9UHW5-1]
RefSeqiNP_001157844.1. NM_001164372.1. [Q9UHW5-3]
NP_001157845.1. NM_001164373.1. [Q9UHW5-2]
NP_057385.3. NM_016301.3. [Q9UHW5-1]
UniGeneiHs.634680.

3D structure databases

ProteinModelPortaliQ9UHW5.
SMRiQ9UHW5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119359. 58 interactors.
IntActiQ9UHW5. 13 interactors.
MINTiMINT-4947564.
STRINGi9606.ENSP00000442770.

PTM databases

iPTMnetiQ9UHW5.
PhosphoSitePlusiQ9UHW5.

Polymorphism and mutation databases

BioMutaiGPN3.
DMDMi158564000.

Proteomic databases

EPDiQ9UHW5.
PaxDbiQ9UHW5.
PeptideAtlasiQ9UHW5.
PRIDEiQ9UHW5.

Protocols and materials databases

DNASUi51184.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000228827; ENSP00000228827; ENSG00000111231. [Q9UHW5-1]
ENST00000537466; ENSP00000443068; ENSG00000111231. [Q9UHW5-2]
ENST00000543199; ENSP00000442770; ENSG00000111231. [Q9UHW5-3]
GeneIDi51184.
KEGGihsa:51184.
UCSCiuc001tqr.4. human. [Q9UHW5-1]

Organism-specific databases

CTDi51184.
GeneCardsiGPN3.
HGNCiHGNC:30186. GPN3.
HPAiHPA039764.
HPA047793.
neXtProtiNX_Q9UHW5.
OpenTargetsiENSG00000111231.
PharmGKBiPA162390164.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1534. Eukaryota.
ENOG410XPBZ. LUCA.
GeneTreeiENSGT00550000074942.
HOVERGENiHBG054729.
InParanoidiQ9UHW5.
KOiK06883.
OMAiYLDPDMY.
OrthoDBiEOG091G0EAS.
PhylomeDBiQ9UHW5.
TreeFamiTF105810.

Miscellaneous databases

ChiTaRSiGPN3. human.
GenomeRNAii51184.
PROiQ9UHW5.

Gene expression databases

BgeeiENSG00000111231.
CleanExiHS_GPN3.
ExpressionAtlasiQ9UHW5. baseline and differential.
GenevisibleiQ9UHW5. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR004130. Gpn.
IPR030228. Gpn3.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR21231. PTHR21231. 1 hit.
PTHR21231:SF7. PTHR21231:SF7. 1 hit.
PfamiPF03029. ATP_bind_1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiGPN3_HUMAN
AccessioniPrimary (citable) accession number: Q9UHW5
Secondary accession number(s): B2RC54
, D4YWV1, F5H759, Q53FS3, Q6UVZ6, Q7Z3D3, Q8NEI2, Q96HK9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: November 2, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.