Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UHP3

- UBP25_HUMAN

UniProt

Q9UHP3 - UBP25_HUMAN

Protein

Ubiquitin carboxyl-terminal hydrolase 25

Gene

USP25

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 142 (01 Oct 2014)
      Sequence version 4 (10 Aug 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions to process newly synthesized Ubiquitin, to recycle ubiquitin molecules or to edit polyubiquitin chains and prevents proteasomal degradation of substrates. Hydrolyzes both 'Lys-48'- and 'Lys-63'-linked tetraubiquitin chains.
    The muscle-specific isoform (USP25m) may have a role in the regulation of muscular differentiation and function.

    Catalytic activityi

    Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei178 – 17811 Publication
    Active sitei599 – 5991By similarity
    Active sitei607 – 6071By similarity

    GO - Molecular functioni

    1. peptidase activity Source: ProtInc
    2. protein binding Source: UniProtKB
    3. SUMO binding Source: UniProtKB
    4. ubiquitin-specific protease activity Source: UniProtKB

    GO - Biological processi

    1. cellular protein modification process Source: ProtInc
    2. protein K48-linked deubiquitination Source: UniProtKB
    3. protein K63-linked deubiquitination Source: UniProtKB
    4. proteolysis Source: ProtInc
    5. ubiquitin-dependent protein catabolic process Source: InterPro

    Keywords - Molecular functioni

    Hydrolase, Protease, Thiol protease

    Keywords - Biological processi

    Ubl conjugation pathway

    Protein family/group databases

    MEROPSiC19.041.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ubiquitin carboxyl-terminal hydrolase 25 (EC:3.4.19.12)
    Alternative name(s):
    Deubiquitinating enzyme 25
    USP on chromosome 21
    Ubiquitin thioesterase 25
    Ubiquitin-specific-processing protease 25
    Gene namesi
    Name:USP25
    Synonyms:USP21
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 21

    Organism-specific databases

    HGNCiHGNC:12624. USP25.

    Subcellular locationi

    Cytoplasm 2 Publications
    Isoform USP25m : Cytoplasm By similarity. Nucleus By similarity
    Note: Some transient punctuate nuclear location in myotubes during myocyte development.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi91 – 911V → A: No interaction with SUMO3; when associated with A-92. 1 Publication
    Mutagenesisi92 – 921I → A: No interaction with SUMO3; when associated with A-91. 1 Publication
    Mutagenesisi99 – 991K → R: Abolishes sumoylation. Decreased enzymatic activity. 2 Publications
    Mutagenesisi178 – 1781C → S: Abrogates deubiquitinating activity. No effect on homo- or oligomerization. 1 Publication
    Mutagenesisi740 – 7401Y → F: No effect on interaction with SYK. 1 Publication
    Mutagenesisi878 – 8781T → I: No effect on interaction with SYK. 1 Publication
    Mutagenesisi880 – 8801Y → F: No effect on interaction with SYK. 1 Publication
    Mutagenesisi883 – 8831I → S: No effect on interaction with SYK. 1 Publication

    Organism-specific databases

    PharmGKBiPA37249.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10551055Ubiquitin carboxyl-terminal hydrolase 25PRO_0000080653Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki99 – 99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
    Cross-linki99 – 99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate1 Publication
    Modified residuei740 – 7401Phosphotyrosine2 Publications

    Post-translational modificationi

    Acetylated.1 Publication
    Sumoylation impairs binding to and hydrolysis of ubiquitin chains. Sumoylated preferentially with SUMO2 or SUMO3. Desumoylated by SENP1. Regulated by ubiquitination on the same residue.1 Publication
    Preferentially monoubiquitinated but can also be polyubiquitinated. Autodeubiquitinated. Ubiquitination activates the enzymatic activity either by preventing sumoylation or by allowing novel interactions.1 Publication
    Phosphorylation in the C-terminal by SYK regulates USP25 cellular levels.2 Publications

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ9UHP3.
    PaxDbiQ9UHP3.
    PRIDEiQ9UHP3.

    PTM databases

    PhosphoSiteiQ9UHP3.

    Expressioni

    Tissue specificityi

    Isoform USB25a is found in most adult and fetal tissues; expression is moderately high in testis, pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, but very low in peripheral blood, colon, small intestine, ovary, prostate, thymus and spleen. Isoform USB25b is found in all tissues except heart and skeletal muscle. Isoform USB25m is heart and skeletal muscle specific.2 Publications

    Inductioni

    The muscle-specific isoform (USP25m) is up-regulated during myocyte differentiation. Levels increase up to 100-fold towards completion of differentiation.1 Publication

    Gene expression databases

    ArrayExpressiQ9UHP3.
    BgeeiQ9UHP3.
    CleanExiHS_USP21.
    HS_USP25.
    GenevestigatoriQ9UHP3.

    Organism-specific databases

    HPAiHPA018297.
    HPA024142.

    Interactioni

    Subunit structurei

    Homodimer or oligomer. Interacts with ACTA1 (via its C-terminus); the interaction occurs for all isoforms but is strongest for isoform USP25m in muscle differentiating cells. Interacts (isoform USP25m only) with MYBPC1; the interaction prevents proteasomal degradation of MYBPC1. Interacts (isoform USP25m only) with FLNC (via filament repeats 17-18, 20-21 and 24). Interacts with GAPDH. Interacts with SUMO3; the interaction sumoylates efficiently USP25. Interacts with SUMO2; the interaction sumoylates efficiently USP25. Interacts with SUMO1; the interaction only weakly sumoylates USP25. Interacts with SYK; phosphorylates USP25 and regulates USP25 intracellular levels.4 Publications

    Protein-protein interaction databases

    BioGridi118895. 34 interactions.
    IntActiQ9UHP3. 18 interactions.
    MINTiMINT-1188384.
    STRINGi9606.ENSP00000285679.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UHP3.
    SMRiQ9UHP3. Positions 1-138, 140-411, 591-676.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini14 – 5744UBA-likeAdd
    BLAST
    Repeati97 – 11620UIM 1Add
    BLAST
    Repeati123 – 14018UIM 2Add
    BLAST
    Domaini169 – 657489USPAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni77 – 10226SUMO interaction domain (SIM)Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili541 – 57838Sequence AnalysisAdd
    BLAST
    Coiled coili684 – 71734Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi89 – 957Required for SUMO paralog-specific binding

    Sequence similaritiesi

    Belongs to the peptidase C19 family.Curated
    Contains 1 UBA-like domain.Curated
    Contains 2 UIM (ubiquitin-interacting motif) repeats.PROSITE-ProRule annotation
    Contains 1 USP domain.Curated

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG5077.
    HOGENOMiHOG000007956.
    HOVERGENiHBG056030.
    InParanoidiQ9UHP3.
    KOiK11849.
    OMAiSRSVIHK.
    OrthoDBiEOG761BSZ.
    PhylomeDBiQ9UHP3.
    TreeFamiTF329035.

    Family and domain databases

    InterProiIPR018200. Pept_C19ubi-hydrolase_C_CS.
    IPR001394. Peptidase_C19_UCH.
    IPR009060. UBA-like.
    IPR003903. Ubiquitin-int_motif.
    IPR028889. UCH/PAN2.
    [Graphical view]
    PfamiPF00443. UCH. 1 hit.
    PF02809. UIM. 2 hits.
    [Graphical view]
    SMARTiSM00726. UIM. 1 hit.
    [Graphical view]
    SUPFAMiSSF46934. SSF46934. 1 hit.
    PROSITEiPS50330. UIM. 1 hit.
    PS00972. USP_1. 1 hit.
    PS00973. USP_2. 1 hit.
    PS50235. USP_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform USP25a (identifier: Q9UHP3-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTVEQNVLQQ SAAQKHQQTF LNQLREITGI NDTQILQQAL KDSNGNLELA     50
    VAFLTAKNAK TPQQEETTYY QTALPGNDRY ISVGSQADTN VIDLTGDDKD 100
    DLQRAIALSL AESNRAFRET GITDEEQAIS RVLEASIAEN KACLKRTPTE 150
    VWRDSRNPYD RKRQDKAPVG LKNVGNTCWF SAVIQSLFNL LEFRRLVLNY 200
    KPPSNAQDLP RNQKEHRNLP FMRELRYLFA LLVGTKRKYV DPSRAVEILK 250
    DAFKSNDSQQ QDVSEFTHKL LDWLEDAFQM KAEEETDEEK PKNPMVELFY 300
    GRFLAVGVLE GKKFENTEMF GQYPLQVNGF KDLHECLEAA MIEGEIESLH 350
    SENSGKSGQE HWFTELPPVL TFELSRFEFN QALGRPEKIH NKLEFPQVLY 400
    LDRYMHRNRE ITRIKREEIK RLKDYLTVLQ QRLERYLSYG SGPKRFPLVD 450
    VLQYALEFAS SKPVCTSPVD DIDASSPPSG SIPSQTLPST TEQQGALSSE 500
    LPSTSPSSVA AISSRSVIHK PFTQSRIPPD LPMHPAPRHI TEEELSVLES 550
    CLHRWRTEIE NDTRDLQESI SRIHRTIELM YSDKSMIQVP YRLHAVLVHE 600
    GQANAGHYWA YIFDHRESRW MKYNDIAVTK SSWEELVRDS FGGYRNASAY 650
    CLMYINDKAQ FLIQEEFNKE TGQPLVGIET LPPDLRDFVE EDNQRFEKEL 700
    EEWDAQLAQK ALQEKLLASQ KLRESETSVT TAQAAGDPEY LEQPSRSDFS 750
    KHLKEETIQI ITKASHEHED KSPETVLQSA IKLEYARLVK LAQEDTPPET 800
    DYRLHHVVVY FIQNQAPKKI IEKTLLEQFG DRNLSFDERC HNIMKVAQAK 850
    LEMIKPEEVN LEEYEEWHQD YRKFRETTMY LIIGLENFQR ESYIDSLLFL 900
    ICAYQNNKEL LSKGLYRGHD EELISHYRRE CLLKLNEQAA ELFESGEDRE 950
    VNNGLIIMNE FIVPFLPLLL VDEMEEKDIL AVEDMRNRWC SYLGQEMEPH 1000
    LQEKLTDFLP KLLDCSMEIK SFHEPPKLPS YSTHELCERF ARIMLSLSRT 1050
    PADGR 1055
    Length:1,055
    Mass (Da):122,218
    Last modified:August 10, 2010 - v4
    Checksum:i0B9CECDCAD619CF2
    GO
    Isoform USP25b (identifier: Q9UHP3-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         779-779: S → SIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK

    Show »
    Length:1,087
    Mass (Da):125,750
    Checksum:i8F852D91651B2C6E
    GO
    Isoform USP25m (identifier: Q9UHP3-3) [UniParc]FASTAAdd to Basket

    Also known as: Muscle-specific isoform

    The sequence of this isoform differs from the canonical sequence as follows:
         779-779: S → SKPENTTSQPLSNQRVVEVAIPHVGKFMIESKEGGYDDEIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK

    Show »
    Length:1,125
    Mass (Da):129,963
    Checksum:i85236A294FFEFD60
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti544 – 5441E → K in AAF32263. (PubMed:10644437)Curated
    Sequence conflicti544 – 5441E → K in ACN76567. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei779 – 7791S → SIMMTPNMQGIIMAIGKSRS VYDRCGPEAGFFK in isoform USP25b. 1 PublicationVSP_039632
    Alternative sequencei779 – 7791S → SKPENTTSQPLSNQRVVEVA IPHVGKFMIESKEGGYDDEI MMTPNMQGIIMAIGKSRSVY DRCGPEAGFFK in isoform USP25m. 1 PublicationVSP_039631

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF170562 mRNA. Translation: AAF32263.1.
    AF134213 mRNA. Translation: AAF24998.1.
    FJ763652 mRNA. Translation: ACN76567.1.
    CH471079 Genomic DNA. Translation: EAX10041.1.
    BC075792 mRNA. Translation: AAH75792.1.
    AK022574 mRNA. Translation: BAB14107.1.
    CCDSiCCDS33515.1. [Q9UHP3-2]
    CCDS63336.1. [Q9UHP3-3]
    CCDS63337.1. [Q9UHP3-1]
    RefSeqiNP_001269970.1. NM_001283041.1. [Q9UHP3-3]
    NP_001269971.1. NM_001283042.1. [Q9UHP3-1]
    NP_037528.3. NM_013396.4. [Q9UHP3-2]
    UniGeneiHs.743994.

    Genome annotation databases

    EnsembliENST00000285679; ENSP00000285679; ENSG00000155313. [Q9UHP3-2]
    ENST00000285681; ENSP00000285681; ENSG00000155313. [Q9UHP3-1]
    ENST00000400183; ENSP00000383044; ENSG00000155313. [Q9UHP3-3]
    GeneIDi29761.
    KEGGihsa:29761.
    UCSCiuc002yjy.1. human. [Q9UHP3-2]
    uc002yjz.1. human. [Q9UHP3-1]
    uc011aby.1. human. [Q9UHP3-3]

    Polymorphism databases

    DMDMi302393833.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF170562 mRNA. Translation: AAF32263.1 .
    AF134213 mRNA. Translation: AAF24998.1 .
    FJ763652 mRNA. Translation: ACN76567.1 .
    CH471079 Genomic DNA. Translation: EAX10041.1 .
    BC075792 mRNA. Translation: AAH75792.1 .
    AK022574 mRNA. Translation: BAB14107.1 .
    CCDSi CCDS33515.1. [Q9UHP3-2 ]
    CCDS63336.1. [Q9UHP3-3 ]
    CCDS63337.1. [Q9UHP3-1 ]
    RefSeqi NP_001269970.1. NM_001283041.1. [Q9UHP3-3 ]
    NP_001269971.1. NM_001283042.1. [Q9UHP3-1 ]
    NP_037528.3. NM_013396.4. [Q9UHP3-2 ]
    UniGenei Hs.743994.

    3D structure databases

    ProteinModelPortali Q9UHP3.
    SMRi Q9UHP3. Positions 1-138, 140-411, 591-676.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118895. 34 interactions.
    IntActi Q9UHP3. 18 interactions.
    MINTi MINT-1188384.
    STRINGi 9606.ENSP00000285679.

    Protein family/group databases

    MEROPSi C19.041.

    PTM databases

    PhosphoSitei Q9UHP3.

    Polymorphism databases

    DMDMi 302393833.

    Proteomic databases

    MaxQBi Q9UHP3.
    PaxDbi Q9UHP3.
    PRIDEi Q9UHP3.

    Protocols and materials databases

    DNASUi 29761.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000285679 ; ENSP00000285679 ; ENSG00000155313 . [Q9UHP3-2 ]
    ENST00000285681 ; ENSP00000285681 ; ENSG00000155313 . [Q9UHP3-1 ]
    ENST00000400183 ; ENSP00000383044 ; ENSG00000155313 . [Q9UHP3-3 ]
    GeneIDi 29761.
    KEGGi hsa:29761.
    UCSCi uc002yjy.1. human. [Q9UHP3-2 ]
    uc002yjz.1. human. [Q9UHP3-1 ]
    uc011aby.1. human. [Q9UHP3-3 ]

    Organism-specific databases

    CTDi 29761.
    GeneCardsi GC21P017102.
    HGNCi HGNC:12624. USP25.
    HPAi HPA018297.
    HPA024142.
    MIMi 604736. gene.
    neXtProti NX_Q9UHP3.
    PharmGKBi PA37249.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5077.
    HOGENOMi HOG000007956.
    HOVERGENi HBG056030.
    InParanoidi Q9UHP3.
    KOi K11849.
    OMAi SRSVIHK.
    OrthoDBi EOG761BSZ.
    PhylomeDBi Q9UHP3.
    TreeFami TF329035.

    Miscellaneous databases

    ChiTaRSi USP25. human.
    GenomeRNAii 29761.
    NextBioi 52254.
    PROi Q9UHP3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UHP3.
    Bgeei Q9UHP3.
    CleanExi HS_USP21.
    HS_USP25.
    Genevestigatori Q9UHP3.

    Family and domain databases

    InterProi IPR018200. Pept_C19ubi-hydrolase_C_CS.
    IPR001394. Peptidase_C19_UCH.
    IPR009060. UBA-like.
    IPR003903. Ubiquitin-int_motif.
    IPR028889. UCH/PAN2.
    [Graphical view ]
    Pfami PF00443. UCH. 1 hit.
    PF02809. UIM. 2 hits.
    [Graphical view ]
    SMARTi SM00726. UIM. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46934. SSF46934. 1 hit.
    PROSITEi PS50330. UIM. 1 hit.
    PS00972. USP_1. 1 hit.
    PS00973. USP_2. 1 hit.
    PS50235. USP_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "USP25, a novel gene encoding a deubiquitinating enzyme, is located in the gene-poor region 21q11.2."
      Valero R., Marfany G., Gonzalez-Angulo O., Gonzalez-Gonzalez G., Puelles L., Gonzalez-Duarte R.
      Genomics 62:395-405(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS USP25A AND USP25B), TISSUE SPECIFICITY.
      Tissue: Fetal brain.
    2. "Narrowing of the region of allelic loss in 21q11-21 in squamous non-small cell lung carcinoma and cloning of a novel ubiquitin-specific protease gene from the deleted segment."
      Groet J., Ives J.H., Jones T.A., Danton M., Flomen R.H., Sheer D., Hrascan R., Pavelic K., Nizetic D.
      Genes Chromosomes Cancer 27:153-161(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM USP25A), FUNCTION.
    3. Valero R., Bosch-Comas A., Denuc A., Gonzalez-Duarte R., Marfany G.
      Submitted (FEB-2009) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM USP25M).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM USP25A).
      Tissue: Placenta.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 319-1055 (ISOFORM USP25A).
    7. "Characterization of alternatively spliced products and tissue-specific isoforms of USP28 and USP25."
      Valero R., Bayes M., Francisca Sanchez-Font M., Gonzalez-Angulo O., Gonzalez-Duarte R., Marfany G.
      Genome Biol. 2:RESEARCH0043.1-RESEARCH0043.10(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY.
    8. "The ubiquitin-specific protease USP25 interacts with three sarcomeric proteins."
      Bosch-Comas A., Lindsten K., Gonzalez-Duarte R., Masucci M.G., Marfany G.
      Cell. Mol. Life Sci. 63:723-734(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, INTERACTION WITH ACTA1; FLNC; GAPDH AND MYBPC1, INDUCTION, SUBCELLULAR LOCATION, POSSIBLE FUNCTION.
    9. "Mechanism and consequences for paralog-specific sumoylation of ubiquitin-specific protease 25."
      Meulmeester E., Kunze M., Hsiao H.H., Urlaub H., Melchior F.
      Mol. Cell 30:610-619(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUMOYLATION AT LYS-99, FUNCTION, INTERACTION WITH SUMO1; SUMO3 AND UBIQUITIN, IDENTIFICATION BY MASS SPECTROMETRY, MUTAGENESIS OF VAL-91; ILE-92 AND LYS-99.
    10. "The UBA-UIM domains of the USP25 regulate the enzyme ubiquitination state and modulate substrate recognition."
      Denuc A., Bosch-Comas A., Gonzalez-Duarte R., Marfany G.
      PLoS ONE 4:E5571-E5571(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION AT LYS-99, DEUBIQUITINATION, ACTIVE SITE CYS-178, ACETYLATION, PHOSPHORYLATION, SUMOYLATION, FUNCTION, SUBCELLULAR LOCATION, SUBUNIT, MUTAGENESIS OF LYS-99 AND CYS-178.
    11. "Functional interaction between the ubiquitin-specific protease 25 and the SYK tyrosine kinase."
      Cholay M., Reverdy C., Benarous R., Colland F., Daviet L.
      Exp. Cell Res. 316:667-675(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SYK, PHOSPHORYLATION AT TYR-740, MUTAGENESIS OF TYR-740; THR-878; TYR-880 AND ILE-883.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiUBP25_HUMAN
    AccessioniPrimary (citable) accession number: Q9UHP3
    Secondary accession number(s): C0LSZ0, Q6DHZ9, Q9H9W1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: August 10, 2010
    Last modified: October 1, 2014
    This is version 142 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 21
      Human chromosome 21: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Peptidase families
      Classification of peptidase families and list of entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3