Q9UHP3 (UBP25_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ubiquitin carboxyl-terminal hydrolase 25 EC=3.4.19.12 Alternative name(s): Deubiquitinating enzyme 25 USP on chromosome 21 Ubiquitin thiolesterase 25 Ubiquitin-specific-processing protease 25 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1055 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions to process newly synthesized Ubiquitin, to recycle ubiquitin molecules or to edit polyubiquitin chains and prevents proteasomal degradation of substrates. Hydrolyzes both 'Lys-48'- and 'Lys-63'-linked tetraubiquitin chains. Ref.2 Ref.7 Ref.8 Ref.10 Ref.11 The muscle-specific USP25m) may have a role in the regulation of muscular differentiation and function. Ref.2 Ref.7 Ref.8 Ref.10 Ref.11 |
| Catalytic activity | Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal). |
| Subunit structure | Homodimer or oligomer. Interacts with ACTA1 (via its C-terminus); the interaction occurs for all isoforms but is strongest for isoform USP25m in muscle differentiating cells. Interacts (isoform USP25m only) with MYBPC1; the interaction prevents proteasomal degradation of MYBPC1. Interacts (isoform USP25m only) with FLNC (via filament repeats 17-18, 20-21 and 24). Interacts with GAPDH. Interacts with SUMO3; the interaction sumoylates efficiently USP25. Interacts with SUMO2; the interaction sumoylates efficiently USP25. Interacts with SUMO1; the interaction only weakly sumoylates USP25. Interacts with SYK; phosphorylates USP25 and regulates USP25 intracellular levels. Ref.8 Ref.10 Ref.11 Ref.12 |
| Subcellular location | Isoform USP25m: Cytoplasm By similarity. Nucleus By similarity. Note: Some transient punctuate nuclear location in myotubes during myocyte development By similarity. Ref.8 Ref.11 |
| Tissue specificity | Isoform USB25a is found in most adult and fetal tissues; expression is moderately high in testis, pancreas, kidney, skeletal muscle, liver, lung, placenta, brain, heart, but very low in peripheral blood, colon, small intestine, ovary, prostate, thymus and spleen. Isoform USB25b is found in all tissues except heart and skeletal muscle. Isoform USB25m is heart and skeletal muscle specific. Ref.1 Ref.7 |
| Induction | The muscle-specific USP25m) is up-regulated during myocyte differentiation. Levels increase up to 100-fold towards completion of differentiation. Ref.8 |
| Post-translational modification | Acetylated. Sumoylation impairs binding to and hydrolysis of ubiquitin chains. Sumoylated preferentially by SUMO2 or SUMO3. Desumoylated by SENP1. Regulated by ubiquitination on the same residue. Ref.10 Ref.11 Preferentially monoubiquitinated but can also be polyubiquitinated. Autodeubiquitinated. Ubiquitination activates the enzymatic activity either by preventing sumoylation or by allowing novel interactions. Phosphorylation in the C-terminal by SYK regulates USP25 cellular levels. |
| Sequence similarities | Belongs to the peptidase C19 family. Contains 1 UBA-like domain. Contains 2 UIM (ubiquitin-interacting motif) repeats. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform USP25a (identifier: Q9UHP3-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform USP25b (identifier: Q9UHP3-1) The sequence of this isoform differs from the canonical sequence as follows: 779-779: S → SIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK | ||||||
| Isoform USP25m (identifier: Q9UHP3-3) Also known as: Muscle-specific isoform; The sequence of this isoform differs from the canonical sequence as follows: 779-779: S → SKPENTTSQPLSNQRVVEVAIPHVGKFMIESKEGGYDDEIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1055 | 1055 | Ubiquitin carboxyl-terminal hydrolase 25 | PRO_0000080653 | |||||
Regions | |||||||||
| Domain | 14 – 57 | 44 | UBA-like | ||||||
| Repeat | 97 – 116 | 20 | UIM 1 | ||||||
| Repeat | 123 – 140 | 18 | UIM 2 | ||||||
| Region | 77 – 102 | 26 | SUMO interaction domain (SIM) | ||||||
| Coiled coil | 541 – 578 | 38 | Potential | ||||||
| Coiled coil | 684 – 717 | 34 | Potential | ||||||
| Motif | 89 – 95 | 7 | Required for SUMO paralog-specific binding | ||||||
Sites | |||||||||
| Active site | 178 | 1 | Ref.11 | ||||||
| Active site | 599 | 1 | By similarity | ||||||
| Active site | 607 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 916 | 1 | Phosphotyrosine Ref.9 | ||||||
| Cross-link | 99 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate Ref.10 Ref.11 | |||||||
| Cross-link | 99 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate | |||||||
Natural variations | |||||||||
| Alternative sequence | 779 | 1 | S → SIMMTPNMQGIIMAIGKSRS VYDRCGPEAGFFK in isoform USP25b. | VSP_039632 | |||||
| Alternative sequence | 779 | 1 | S → SKPENTTSQPLSNQRVVEVA IPHVGKFMIESKEGGYDDEI MMTPNMQGIIMAIGKSRSVY DRCGPEAGFFK in isoform USP25m. | VSP_039631 | |||||
Experimental info | |||||||||
| Mutagenesis | 91 | 1 | V → A: No interaction with SUMO3; when associated with A-92. Ref.10 | ||||||
| Mutagenesis | 92 | 1 | I → A: No interaction with SUMO3; when associated with A-91. Ref.10 | ||||||
| Mutagenesis | 99 | 1 | K → R: Abolishes sumoylation. Decreased enzymatic activity. Ref.10 Ref.11 | ||||||
| Mutagenesis | 178 | 1 | C → S: Abrogates deubiquitinating activity. No effect on homo- or oligomerization. Ref.11 | ||||||
| Mutagenesis | 740 | 1 | Y → F: No effect on interaction with SYK. Ref.12 | ||||||
| Mutagenesis | 878 | 1 | T → I: No effect on interaction with SYK. Ref.12 | ||||||
| Mutagenesis | 880 | 1 | Y → F: No effect on interaction with SYK. Ref.12 | ||||||
| Mutagenesis | 883 | 1 | I → S: No effect on interaction with SYK. Ref.12 | ||||||
| Sequence conflict | 544 | 1 | E → K in AAF32263. Ref.1 | ||||||
| Sequence conflict | 544 | 1 | E → K in ACN76567. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "USP25, a novel gene encoding a deubiquitinating enzyme, is located in the gene-poor region 21q11.2." Valero R., Marfany G., Gonzalez-Angulo O., Gonzalez-Gonzalez G., Puelles L., Gonzalez-Duarte R. Genomics 62:395-405(1999) [PubMed: 10644437] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS USP25A AND USP25B), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | "Narrowing of the region of allelic loss in 21q11-21 in squamous non-small cell lung carcinoma and cloning of a novel ubiquitin-specific protease gene from the deleted segment." Groet J., Ives J.H., Jones T.A., Danton M., Flomen R.H., Sheer D., Hrascan R., Pavelic K., Nizetic D. Genes Chromosomes Cancer 27:153-161(2000) [PubMed: 10612803] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM USP25A), FUNCTION. |
| [3] | Valero R., Bosch-Comas A., Denuc A., Gonzalez-Duarte R., Marfany G. Submitted (FEB-2009) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM USP25M). |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM USP25A). Tissue: Placenta. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 319-1055 (ISOFORM USP25A). |
| [7] | "Characterization of alternatively spliced products and tissue-specific isoforms of USP28 and USP25." Valero R., Bayes M., Francisca Sanchez-Font M., Gonzalez-Angulo O., Gonzalez-Duarte R., Marfany G. Genome Biol. 2:RESEARCH0043.1-RESEARCH0043.10(2001) [PubMed: 11597335] [Abstract] Cited for: ALTERNATIVE SPLICING, FUNCTION, TISSUE SPECIFICITY. |
| [8] | "The ubiquitin-specific protease USP25 interacts with three sarcomeric proteins." Bosch-Comas A., Lindsten K., Gonzalez-Duarte R., Masucci M.G., Marfany G. Cell. Mol. Life Sci. 63:723-734(2006) [PubMed: 16501887] [Abstract] Cited for: ALTERNATIVE SPLICING, INTERACTION WITH ACTA1; FLNC; GAPDH AND MYBPC1, INDUCTION, SUBCELLULAR LOCATION, POSSIBLE FUNCTION. |
| [9] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-916, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Mechanism and consequences for paralog-specific sumoylation of ubiquitin-specific protease 25." Meulmeester E., Kunze M., Hsiao H.H., Urlaub H., Melchior F. Mol. Cell 30:610-619(2008) [PubMed: 18538659] [Abstract] Cited for: SUMOYLATION AT LYS-99, FUNCTION, INTERACTION WITH SUMO1; SUMO3 AND UBIQUITIN, MASS SPECTROMETRY, MUTAGENESIS OF VAL-91; ILE-92 AND LYS-99. |
| [11] | "The UBA-UIM domains of the USP25 regulate the enzyme ubiquitination state and modulate substrate recognition." Denuc A., Bosch-Comas A., Gonzalez-Duarte R., Marfany G. PLoS ONE 4:E5571-E5571(2009) [PubMed: 19440361] [Abstract] Cited for: UBIQUITINATION AT LYS-99, DEUBIQUITINATION, ACTIVE SITE AT CYS-178, ACETYLATION, PHOSPHORYLATION, SUMOYLATION, FUNCTION, SUBCELLULAR LOCATION, SUBUNIT, MUTAGENESIS OF LYS-99 AND CYS-178. |
| [12] | "Functional interaction between the ubiquitin-specific protease 25 and the SYK tyrosine kinase." Cholay M., Reverdy C., Benarous R., Colland F., Daviet L. Exp. Cell Res. 316:667-675(2010) [PubMed: 19909739] [Abstract] Cited for: INTERACTION WITH SYK, PHOSPHORYLATION AT TYR-740, MUTAGENESIS OF TYR-740; THR-878; TYR-880 AND ILE-883. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF170562 mRNA. Translation: AAF32263.1. AF134213 mRNA. Translation: AAF24998.1. FJ763652 mRNA. Translation: ACN76567.1. CH471079 Genomic DNA. Translation: EAX10041.1. BC075792 mRNA. Translation: AAH75792.1. AK022574 mRNA. Translation: BAB14107.1. |
| IPI | IPI00219886. IPI00300439. IPI00791721. |
| RefSeq | NP_037528.3. NM_013396.3. |
| UniGene | Hs.473370. |
3D structure databases | |
| ProteinModelPortal | Q9UHP3. |
| SMR | Q9UHP3. Positions 1-68. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UHP3. 13 interactions. |
| MINT | MINT-1188384. |
| STRING | Q9UHP3. |
Protein family/group databases | |
| MEROPS | C19.041. |
PTM databases | |
| PhosphoSite | Q9UHP3. |
Polymorphism databases | |
| DMDM | 302393833. |
Proteomic databases | |
| PRIDE | Q9UHP3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000285681; ENSP00000285681; ENSG00000155313. |
| GeneID | 29761. |
| KEGG | hsa:29761. |
| UCSC | uc002yjy.1. human. uc002yjz.1. human. |
Organism-specific databases | |
| CTD | 29761. |
| GeneCards | GC21P017102. |
| HGNC | HGNC:12624. USP25. |
| HPA | HPA018297. HPA024142. |
| MIM | 604736. gene. |
| neXtProt | NX_Q9UHP3. |
| PharmGKB | PA37249. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000016082. |
| HOGENOM | HBG358355. |
| HOVERGEN | HBG056030. |
| InParanoid | Q9UHP3. |
| OMA | KHQQTFL. |
| OrthoDB | EOG49S65J. |
Gene expression databases | |
| ArrayExpress | Q9UHP3. |
| Bgee | Q9UHP3. |
| CleanEx | HS_USP21. HS_USP25. |
| Genevestigator | Q9UHP3. |
| GermOnline | ENSG00000155313. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018200. Pept_C19ubi-hydrolase_C_CS. IPR001394. Peptidase_C19. IPR009060. UBA-like. IPR003903. Ubiquitin-int_motif. [Graphical view] |
| KO | K11849. |
| Pfam | PF00443. UCH. 1 hit. PF02809. UIM. 2 hits. [Graphical view] |
| SMART | SM00726. UIM. 1 hit. [Graphical view] |
| SUPFAM | SSF46934. UBA_like. 1 hit. |
| PROSITE | PS00972. UCH_2_1. 1 hit. PS00973. UCH_2_2. 1 hit. PS50235. UCH_2_3. 1 hit. PS50330. UIM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 52254. |
| SOURCE | Search... |
Entry information
| Entry name | UBP25_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UHP3 Secondary accession number(s): C0LSZ0, Q6DHZ9, Q9H9W1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with