Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Inositol hexakisphosphate kinase 2

Gene

IP6K2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.1 Publication

Catalytic activityi

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.
ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.

GO - Molecular functioni

GO - Biological processi

  • inositol phosphate metabolic process Source: Reactome
  • negative regulation of cell growth Source: UniProtKB
  • phosphate ion transport Source: Ensembl
  • phosphatidylinositol phosphorylation Source: UniProtKB
  • positive regulation of apoptotic process Source: UniProtKB
  • type I interferon signaling pathway Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS00942-MONOMER.
ZFISH:HS00942-MONOMER.
BRENDAi2.7.4.21. 2681.
ReactomeiR-HSA-1855191. Synthesis of IPs in the nucleus.
R-HSA-909733. Interferon alpha/beta signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Inositol hexakisphosphate kinase 2 (EC:2.7.4.21)
Short name:
InsP6 kinase 2
Alternative name(s):
P(i)-uptake stimulator
Short name:
PiUS
Gene namesi
Name:IP6K2
Synonyms:IHPK2
ORF Names:TCCCIA00113
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:17313. IP6K2.

Subcellular locationi

GO - Cellular componenti

  • intermediate filament cytoskeleton Source: HPA
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51447.
OpenTargetsiENSG00000068745.
PharmGKBiPA164720999.

Polymorphism and mutation databases

BioMutaiIP6K2.
DMDMi50400688.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000668771 – 426Inositol hexakisphosphate kinase 2Add BLAST426

Proteomic databases

EPDiQ9UHH9.
PaxDbiQ9UHH9.
PeptideAtlasiQ9UHH9.
PRIDEiQ9UHH9.

PTM databases

iPTMnetiQ9UHH9.
PhosphoSitePlusiQ9UHH9.

Expressioni

Gene expression databases

BgeeiENSG00000068745.
CleanExiHS_IP6K2.
ExpressionAtlasiQ9UHH9. baseline and differential.
GenevisibleiQ9UHH9. HS.

Organism-specific databases

HPAiHPA007532.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MEOX2A4D1273EBI-747509,EBI-10172134
RBPMSQ930623EBI-747509,EBI-740322

Protein-protein interaction databases

BioGridi119546. 12 interactors.
DIPiDIP-29676N.
IntActiQ9UHH9. 6 interactors.
MINTiMINT-1474997.
STRINGi9606.ENSP00000331103.

Structurei

3D structure databases

ProteinModelPortaliQ9UHH9.
SMRiQ9UHH9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni216 – 224Substrate bindingBy similarity9

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1620. Eukaryota.
ENOG410YB60. LUCA.
GeneTreeiENSGT00390000014381.
HOVERGENiHBG052140.
InParanoidiQ9UHH9.
KOiK07756.
OMAiKEWVRQH.
OrthoDBiEOG091G0JK2.
PhylomeDBiQ9UHH9.
TreeFamiTF314066.

Family and domain databases

InterProiIPR005522. IPK.
[Graphical view]
PANTHERiPTHR12400. PTHR12400. 2 hits.
PfamiPF03770. IPK. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UHH9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPAFRAMDV EPRAKGVLLE PFVHQVGGHS CVLRFNETTL CKPLVPREHQ
60 70 80 90 100
FYETLPAEMR KFTPQYKGVV SVRFEEDEDR NLCLIAYPLK GDHGIVDIVD
110 120 130 140 150
NSDCEPKSKL LRWTTNKKHH VLETEKTPKD WVRQHRKEEK MKSHKLEEEF
160 170 180 190 200
EWLKKSEVLY YTVEKKGNIS SQLKHYNPWS MKCHQQQLQR MKENAKHRNQ
210 220 230 240 250
YKFILLENLT SRYEVPCVLD LKMGTRQHGD DASEEKAANQ IRKCQQSTSA
260 270 280 290 300
VIGVRVCGMQ VYQAGSGQLM FMNKYHGRKL SVQGFKEALF QFFHNGRYLR
310 320 330 340 350
RELLGPVLKK LTELKAVLER QESYRFYSSS LLVIYDGKER PEVVLDSDAE
360 370 380 390 400
DLEDLSEESA DESAGAYAYK PIGASSVDVR MIDFAHTTCR LYGEDTVVHE
410 420
GQDAGYIFGL QSLIDIVTEI SEESGE
Length:426
Mass (Da):49,186
Last modified:July 19, 2004 - v2
Checksum:i11BDFF12C22EECFB
GO
Isoform 2 (identifier: Q9UHH9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-97: VVSVRFEEDEDRNLCLIAYPLKGDHGIVD → QSQRPLVSWPSLPHFFPWSFPLWPQGSVA
     98-426: Missing.

Show »
Length:97
Mass (Da):11,180
Checksum:i20CD12C8CB9E4287
GO
Isoform 3 (identifier: Q9UHH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: V → S
     71-426: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:70
Mass (Da):8,004
Checksum:iB44FEE3FD8C14391
GO
Isoform 4 (identifier: Q9UHH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSLNLPEASLLSRASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.

Show »
Length:185
Mass (Da):20,924
Checksum:iD52B5B42D42D1472
GO
Isoform 5 (identifier: Q9UHH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNLCQSPFQEGCQSLLASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.

Show »
Length:188
Mass (Da):21,291
Checksum:i86D9872EAD7F79F6
GO
Isoform 6 (identifier: Q9UHH9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-87: VVSVRFEEDEDRNLCLIAY → DISSHQHGGVFVGEWGSLL
     88-426: Missing.

Note: No experimental confirmation available.
Show »
Length:87
Mass (Da):9,825
Checksum:i30E2F170A5B95C9B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti99 – 100VD → AH in AAF15057 (PubMed:10574768).Curated2
Sequence conflicti167G → W in AAH65533 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0426981M → MSLNLPEASLLSRASWPEQA KEPRREGHTDKQQTEDVLAA GLRCLPHLPAICARRM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0428451M → MNLCQSPFQEGCQSLLASWP EQAKEPRREGHTDKQQTEDV LAAGLRCLPHLPAICARRM in isoform 5. 1 Publication1
Alternative sequenceiVSP_04269969 – 130VVSVR…KTPKD → KSQLLEGLPHWRGDVRDRGH GRPWQPSLEPSLPPTLCFPS LSSFSSSWPSAQHLTPSVFN PW in isoform 4 and isoform 5. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_01092569 – 97VVSVR…HGIVD → QSQRPLVSWPSLPHFFPWSF PLWPQGSVA in isoform 2. 2 PublicationsAdd BLAST29
Alternative sequenceiVSP_04541669 – 87VVSVR…CLIAY → DISSHQHGGVFVGEWGSLL in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01092670V → S in isoform 3. 1 Publication1
Alternative sequenceiVSP_01092771 – 426Missing in isoform 3. 1 PublicationAdd BLAST356
Alternative sequenceiVSP_04541788 – 426Missing in isoform 6. 1 PublicationAdd BLAST339
Alternative sequenceiVSP_01092898 – 426Missing in isoform 2. 2 PublicationsAdd BLAST329
Alternative sequenceiVSP_042700131 – 426Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST296

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177145 mRNA. Translation: AAF15057.1.
AY007091 mRNA. Translation: AAG01984.1.
AK290526 mRNA. Translation: BAF83215.1.
AK304714 mRNA. Translation: BAG65478.1.
AC141002 Genomic DNA. No translation available.
BC001864 mRNA. No translation available.
BC004469 mRNA. Translation: AAH04469.2.
BC019694 mRNA. Translation: AAH19694.1.
BC065533 mRNA. Translation: AAH65533.1.
CA488567 mRNA. No translation available.
AL117458 mRNA. Translation: CAB55936.1.
AL137514 mRNA. Translation: CAB70780.1.
CCDSiCCDS2777.1. [Q9UHH9-1]
CCDS33752.1. [Q9UHH9-2]
CCDS54579.1. [Q9UHH9-6]
CCDS54580.1. [Q9UHH9-4]
CCDS54581.1. [Q9UHH9-5]
PIRiT17246.
T46275.
RefSeqiNP_001005909.1. NM_001005909.2. [Q9UHH9-1]
NP_001005910.1. NM_001005910.2. [Q9UHH9-2]
NP_001005911.1. NM_001005911.2. [Q9UHH9-2]
NP_001139650.1. NM_001146178.2. [Q9UHH9-6]
NP_001139651.1. NM_001146179.2. [Q9UHH9-6]
NP_001177245.1. NM_001190316.1. [Q9UHH9-4]
NP_001177246.1. NM_001190317.1. [Q9UHH9-5]
NP_057375.2. NM_016291.3. [Q9UHH9-1]
XP_011532124.1. XM_011533822.1. [Q9UHH9-6]
XP_011532125.1. XM_011533823.1. [Q9UHH9-6]
XP_016862072.1. XM_017006583.1. [Q9UHH9-1]
XP_016862073.1. XM_017006584.1. [Q9UHH9-1]
XP_016862074.1. XM_017006585.1. [Q9UHH9-1]
UniGeneiHs.595983.

Genome annotation databases

EnsembliENST00000328631; ENSP00000331103; ENSG00000068745. [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745. [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745. [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745. [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745. [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745. [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745. [Q9UHH9-5]
GeneIDi51447.
KEGGihsa:51447.
UCSCiuc003cuq.4. human. [Q9UHH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF177145 mRNA. Translation: AAF15057.1.
AY007091 mRNA. Translation: AAG01984.1.
AK290526 mRNA. Translation: BAF83215.1.
AK304714 mRNA. Translation: BAG65478.1.
AC141002 Genomic DNA. No translation available.
BC001864 mRNA. No translation available.
BC004469 mRNA. Translation: AAH04469.2.
BC019694 mRNA. Translation: AAH19694.1.
BC065533 mRNA. Translation: AAH65533.1.
CA488567 mRNA. No translation available.
AL117458 mRNA. Translation: CAB55936.1.
AL137514 mRNA. Translation: CAB70780.1.
CCDSiCCDS2777.1. [Q9UHH9-1]
CCDS33752.1. [Q9UHH9-2]
CCDS54579.1. [Q9UHH9-6]
CCDS54580.1. [Q9UHH9-4]
CCDS54581.1. [Q9UHH9-5]
PIRiT17246.
T46275.
RefSeqiNP_001005909.1. NM_001005909.2. [Q9UHH9-1]
NP_001005910.1. NM_001005910.2. [Q9UHH9-2]
NP_001005911.1. NM_001005911.2. [Q9UHH9-2]
NP_001139650.1. NM_001146178.2. [Q9UHH9-6]
NP_001139651.1. NM_001146179.2. [Q9UHH9-6]
NP_001177245.1. NM_001190316.1. [Q9UHH9-4]
NP_001177246.1. NM_001190317.1. [Q9UHH9-5]
NP_057375.2. NM_016291.3. [Q9UHH9-1]
XP_011532124.1. XM_011533822.1. [Q9UHH9-6]
XP_011532125.1. XM_011533823.1. [Q9UHH9-6]
XP_016862072.1. XM_017006583.1. [Q9UHH9-1]
XP_016862073.1. XM_017006584.1. [Q9UHH9-1]
XP_016862074.1. XM_017006585.1. [Q9UHH9-1]
UniGeneiHs.595983.

3D structure databases

ProteinModelPortaliQ9UHH9.
SMRiQ9UHH9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119546. 12 interactors.
DIPiDIP-29676N.
IntActiQ9UHH9. 6 interactors.
MINTiMINT-1474997.
STRINGi9606.ENSP00000331103.

PTM databases

iPTMnetiQ9UHH9.
PhosphoSitePlusiQ9UHH9.

Polymorphism and mutation databases

BioMutaiIP6K2.
DMDMi50400688.

Proteomic databases

EPDiQ9UHH9.
PaxDbiQ9UHH9.
PeptideAtlasiQ9UHH9.
PRIDEiQ9UHH9.

Protocols and materials databases

DNASUi51447.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328631; ENSP00000331103; ENSG00000068745. [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745. [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745. [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745. [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745. [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745. [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745. [Q9UHH9-5]
GeneIDi51447.
KEGGihsa:51447.
UCSCiuc003cuq.4. human. [Q9UHH9-1]

Organism-specific databases

CTDi51447.
DisGeNETi51447.
GeneCardsiIP6K2.
HGNCiHGNC:17313. IP6K2.
HPAiHPA007532.
MIMi606992. gene.
neXtProtiNX_Q9UHH9.
OpenTargetsiENSG00000068745.
PharmGKBiPA164720999.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1620. Eukaryota.
ENOG410YB60. LUCA.
GeneTreeiENSGT00390000014381.
HOVERGENiHBG052140.
InParanoidiQ9UHH9.
KOiK07756.
OMAiKEWVRQH.
OrthoDBiEOG091G0JK2.
PhylomeDBiQ9UHH9.
TreeFamiTF314066.

Enzyme and pathway databases

BioCyciMetaCyc:HS00942-MONOMER.
ZFISH:HS00942-MONOMER.
BRENDAi2.7.4.21. 2681.
ReactomeiR-HSA-1855191. Synthesis of IPs in the nucleus.
R-HSA-909733. Interferon alpha/beta signaling.

Miscellaneous databases

ChiTaRSiIP6K2. human.
GeneWikiiIHPK2.
GenomeRNAii51447.
PROiQ9UHH9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000068745.
CleanExiHS_IP6K2.
ExpressionAtlasiQ9UHH9. baseline and differential.
GenevisibleiQ9UHH9. HS.

Family and domain databases

InterProiIPR005522. IPK.
[Graphical view]
PANTHERiPTHR12400. PTHR12400. 2 hits.
PfamiPF03770. IPK. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIP6K2_HUMAN
AccessioniPrimary (citable) accession number: Q9UHH9
Secondary accession number(s): A8K3B1
, B4E3G6, G8JLL6, Q6P0N8, Q9BSZ6, Q9BUW3, Q9H4P7, Q9NT63, Q9UFU6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: November 30, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.