Q9UHH9 (IP6K2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inositol hexakisphosphate kinase 2 Short name=InsP6 kinase 2 EC=2.7.4.21 Alternative name(s): P(i)-uptake stimulator Short name=PiUS | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 426 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Ref.1 |
| Catalytic activity | ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate. ATP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol diphosphate tetrakisphosphate (isomeric configuration unknown). |
| Subcellular location | |
| Sequence similarities | Belongs to the inositol phosphokinase (IPK) family. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UHH9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UHH9-2) The sequence of this isoform differs from the canonical sequence as follows: 69-97: VVSVRFEEDEDRNLCLIAYPLKGDHGIVD → QSQRPLVSWPSLPHFFPWSFPLWPQGSVA 98-426: Missing. | ||||||
| Isoform 3 (identifier: Q9UHH9-3) The sequence of this isoform differs from the canonical sequence as follows: 70-70: V → S 71-426: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q9UHH9-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSLNLPEASLLSRASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM 69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW 131-426: Missing. | ||||||
| Isoform 5 (identifier: Q9UHH9-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MNLCQSPFQEGCQSLLASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM 69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW 131-426: Missing. | ||||||
| Isoform 6 (identifier: Q9UHH9-6) The sequence of this isoform differs from the canonical sequence as follows: 69-87: VVSVRFEEDEDRNLCLIAY → DISSHQHGGVFVGEWGSLL 88-426: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 426 | 426 | Inositol hexakisphosphate kinase 2 | PRO_0000066877 | |||||
Regions | |||||||||
| Region | 216 – 224 | 9 | Substrate binding By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSLNLPEASLLSRASWPEQA KEPRREGHTDKQQTEDVLAA GLRCLPHLPAICARRM in isoform 4. | VSP_042698 | |||||
| Alternative sequence | 1 | 1 | M → MNLCQSPFQEGCQSLLASWP EQAKEPRREGHTDKQQTEDV LAAGLRCLPHLPAICARRM in isoform 5. | VSP_042845 | |||||
| Alternative sequence | 69 – 130 | 62 | VVSVR…KTPKD → KSQLLEGLPHWRGDVRDRGH GRPWQPSLEPSLPPTLCFPS LSSFSSSWPSAQHLTPSVFN PW in isoform 4 and isoform 5. | VSP_042699 | |||||
| Alternative sequence | 69 – 97 | 29 | VVSVR…HGIVD → QSQRPLVSWPSLPHFFPWSF PLWPQGSVA in isoform 2. | VSP_010925 | |||||
| Alternative sequence | 69 – 87 | 19 | VVSVR…CLIAY → DISSHQHGGVFVGEWGSLL in isoform 6. | VSP_045416 | |||||
| Alternative sequence | 70 | 1 | V → S in isoform 3. | VSP_010926 | |||||
| Alternative sequence | 71 – 426 | 356 | Missing in isoform 3. | VSP_010927 | |||||
| Alternative sequence | 88 – 426 | 339 | Missing in isoform 6. | VSP_045417 | |||||
| Alternative sequence | 98 – 426 | 329 | Missing in isoform 2. | VSP_010928 | |||||
| Alternative sequence | 131 – 426 | 296 | Missing in isoform 4 and isoform 5. | VSP_042700 | |||||
Experimental info | |||||||||
| Sequence conflict | 99 – 100 | 2 | VD → AH in AAF15057. Ref.1 | ||||||
| Sequence conflict | 167 | 1 | G → W in AAH65533. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases." Saiardi A., Erdjument-Bromage H., Snowman A.M., Tempst P., Snyder S.H. Curr. Biol. 9:1323-1326(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [2] | "Pediatric leukemia cDNA sequencing project." Zhou J., Yu W., Tang H., Mei G., Tsang Y.T.M., Bouck J., Gibbs R.A., Margolin J.F. Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Leukemia. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5). Tissue: Brain and Uterus. |
| [4] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 6). Tissue: Brain, Lung and Skin. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 76-426 (ISOFORMS 1 AND 2). Tissue: Uterus. |
| [7] | "Identification and characterization of a novel inositol hexakisphosphate kinase." Saiardi A., Nagata E., Luo H.R., Snowman A.M., Snyder S.H. J. Biol. Chem. 276:39179-39185(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF177145 mRNA. Translation: AAF15057.1. AY007091 mRNA. Translation: AAG01984.1. AK290526 mRNA. Translation: BAF83215.1. AK304714 mRNA. Translation: BAG65478.1. AC141002 Genomic DNA. No translation available. BC001864 mRNA. No translation available. BC004469 mRNA. Translation: AAH04469.2. BC019694 mRNA. Translation: AAH19694.1. BC065533 mRNA. Translation: AAH65533.1. CA488567 mRNA. No translation available. AL117458 mRNA. Translation: CAB55936.1. AL137514 mRNA. Translation: CAB70780.1. |
| IPI | IPI00385653. IPI00426289. IPI00426291. |
| PIR | T17246. T46275. |
| RefSeq | NP_001005909.1. NM_001005909.2. NP_001005910.1. NM_001005910.2. NP_001005911.1. NM_001005911.2. NP_001139650.1. NM_001146178.2. NP_001139651.1. NM_001146179.2. NP_001177245.1. NM_001190316.1. NP_001177246.1. NM_001190317.1. NP_057375.2. NM_016291.3. |
| UniGene | Hs.595983. |
3D structure databases | |
| ProteinModelPortal | Q9UHH9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29676N. |
| IntAct | Q9UHH9. 1 interaction. |
| MINT | MINT-1474997. |
| STRING | 9606.ENSP00000331103. |
PTM databases | |
| PhosphoSite | Q9UHH9. |
Polymorphism databases | |
| DMDM | 50400688. |
Proteomic databases | |
| PaxDb | Q9UHH9. |
| PRIDE | Q9UHH9. |
Protocols and materials databases | |
| DNASU | 51447. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000328631; ENSP00000331103; ENSG00000068745. ENST00000340879; ENSP00000341925; ENSG00000068745. ENST00000413298; ENSP00000396203; ENSG00000068745. ENST00000416707; ENSP00000387759; ENSG00000068745. ENST00000431721; ENSP00000414139; ENSG00000068745. ENST00000432678; ENSP00000400812; ENSG00000068745. ENST00000446860; ENSP00000399052; ENSG00000068745. |
| GeneID | 51447. |
| KEGG | hsa:51447. |
| UCSC | uc003cup.3. human. uc003cur.3. human. uc011bbq.2. human. uc011bbt.2. human. uc011bbv.2. human. |
Organism-specific databases | |
| CTD | 51447. |
| GeneCards | GC03M048725. |
| HGNC | HGNC:17313. IP6K2. |
| HPA | HPA007532. |
| MIM | 606992. gene. |
| neXtProt | NX_Q9UHH9. |
| PharmGKB | PA164720999. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG274869. |
| HOVERGEN | HBG052140. |
| KO | K07756. |
| OMA | KEWVRQH. |
| OrthoDB | EOG4DR9C8. |
| PhylomeDB | Q9UHH9. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS00942-MONOMER. |
| BRENDA | 2.7.4.21. 2681. |
| Reactome | REACT_111217. Metabolism. REACT_6900. Immune System. |
Gene expression databases | |
| ArrayExpress | Q9UHH9. |
| Bgee | Q9UHH9. |
| CleanEx | HS_IP6K2. |
| Genevestigator | Q9UHH9. |
| GermOnline | ENSG00000068745. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005522. IPK. [Graphical view] |
| PANTHER | PTHR12400. PTHR12400. 1 hit. |
| Pfam | PF03770. IPK. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 51447. |
| NextBio | 55041. |
| SOURCE | Search... |
Entry information
| Entry name | IP6K2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UHH9 Secondary accession number(s): A8K3B1 Q9UFU6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
