Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UHH9 (IP6K2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Inositol hexakisphosphate kinase 2

Short name=InsP6 kinase 2
EC=2.7.4.21
Alternative name(s):
P(i)-uptake stimulator
Short name=PiUS
Gene names
Name:IP6K2
Synonyms:IHPK2
ORF Names:TCCCIA00113
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length426 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Ref.1

Catalytic activity

ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.

ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.

Subcellular location

Nucleus Ref.7.

Sequence similarities

Belongs to the inositol phosphokinase (IPK) family.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   LigandATP-binding
Nucleotide-binding
   Molecular functionKinase
Transferase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcytokine-mediated signaling pathway

Traceable author statement. Source: Reactome

inositol phosphate metabolic process

Traceable author statement. Source: Reactome

negative regulation of cell growth

Inferred from mutant phenotype PubMed 11337497. Source: UniProtKB

phosphate ion transport

Inferred from electronic annotation. Source: Ensembl

phosphatidylinositol phosphorylation

Inferred from direct assay Ref.1. Source: UniProtKB

positive regulation of apoptotic process

Inferred from mutant phenotype PubMed 11337497. Source: UniProtKB

small molecule metabolic process

Traceable author statement. Source: Reactome

type I interferon signaling pathway

Traceable author statement. Source: Reactome

   Cellular_componentintermediate filament cytoskeleton

Inferred from direct assay. Source: HPA

nucleoplasm

Traceable author statement. Source: Reactome

nucleus

Inferred from direct assay Ref.7. Source: UniProtKB

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

inositol hexakisphosphate 1-kinase activity

Inferred from electronic annotation. Source: UniProtKB-EC

inositol hexakisphosphate 3-kinase activity

Inferred from electronic annotation. Source: UniProtKB-EC

inositol hexakisphosphate 5-kinase activity

Inferred from electronic annotation. Source: UniProtKB-EC

inositol-1,4,5-trisphosphate 3-kinase activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9UHH9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UHH9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     69-97: VVSVRFEEDEDRNLCLIAYPLKGDHGIVD → QSQRPLVSWPSLPHFFPWSFPLWPQGSVA
     98-426: Missing.
Isoform 3 (identifier: Q9UHH9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: V → S
     71-426: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: Q9UHH9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSLNLPEASLLSRASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.
Isoform 5 (identifier: Q9UHH9-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNLCQSPFQEGCQSLLASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
     69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
     131-426: Missing.
Isoform 6 (identifier: Q9UHH9-6)

The sequence of this isoform differs from the canonical sequence as follows:
     69-87: VVSVRFEEDEDRNLCLIAY → DISSHQHGGVFVGEWGSLL
     88-426: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 426426Inositol hexakisphosphate kinase 2
PRO_0000066877

Regions

Region216 – 2249Substrate binding By similarity

Natural variations

Alternative sequence11M → MSLNLPEASLLSRASWPEQA KEPRREGHTDKQQTEDVLAA GLRCLPHLPAICARRM in isoform 4.
VSP_042698
Alternative sequence11M → MNLCQSPFQEGCQSLLASWP EQAKEPRREGHTDKQQTEDV LAAGLRCLPHLPAICARRM in isoform 5.
VSP_042845
Alternative sequence69 – 13062VVSVR…KTPKD → KSQLLEGLPHWRGDVRDRGH GRPWQPSLEPSLPPTLCFPS LSSFSSSWPSAQHLTPSVFN PW in isoform 4 and isoform 5.
VSP_042699
Alternative sequence69 – 9729VVSVR…HGIVD → QSQRPLVSWPSLPHFFPWSF PLWPQGSVA in isoform 2.
VSP_010925
Alternative sequence69 – 8719VVSVR…CLIAY → DISSHQHGGVFVGEWGSLL in isoform 6.
VSP_045416
Alternative sequence701V → S in isoform 3.
VSP_010926
Alternative sequence71 – 426356Missing in isoform 3.
VSP_010927
Alternative sequence88 – 426339Missing in isoform 6.
VSP_045417
Alternative sequence98 – 426329Missing in isoform 2.
VSP_010928
Alternative sequence131 – 426296Missing in isoform 4 and isoform 5.
VSP_042700

Experimental info

Sequence conflict99 – 1002VD → AH in AAF15057. Ref.1
Sequence conflict1671G → W in AAH65533. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 19, 2004. Version 2.
Checksum: 11BDFF12C22EECFB

FASTA42649,186
        10         20         30         40         50         60 
MSPAFRAMDV EPRAKGVLLE PFVHQVGGHS CVLRFNETTL CKPLVPREHQ FYETLPAEMR 

        70         80         90        100        110        120 
KFTPQYKGVV SVRFEEDEDR NLCLIAYPLK GDHGIVDIVD NSDCEPKSKL LRWTTNKKHH 

       130        140        150        160        170        180 
VLETEKTPKD WVRQHRKEEK MKSHKLEEEF EWLKKSEVLY YTVEKKGNIS SQLKHYNPWS 

       190        200        210        220        230        240 
MKCHQQQLQR MKENAKHRNQ YKFILLENLT SRYEVPCVLD LKMGTRQHGD DASEEKAANQ 

       250        260        270        280        290        300 
IRKCQQSTSA VIGVRVCGMQ VYQAGSGQLM FMNKYHGRKL SVQGFKEALF QFFHNGRYLR 

       310        320        330        340        350        360 
RELLGPVLKK LTELKAVLER QESYRFYSSS LLVIYDGKER PEVVLDSDAE DLEDLSEESA 

       370        380        390        400        410        420 
DESAGAYAYK PIGASSVDVR MIDFAHTTCR LYGEDTVVHE GQDAGYIFGL QSLIDIVTEI 


SEESGE 

« Hide

Isoform 2 [UniParc].

Checksum: 20CD12C8CB9E4287
Show »

FASTA9711,180
Isoform 3 [UniParc].

Checksum: B44FEE3FD8C14391
Show »

FASTA708,004
Isoform 4 [UniParc].

Checksum: D52B5B42D42D1472
Show »

FASTA18520,924
Isoform 5 [UniParc].

Checksum: 86D9872EAD7F79F6
Show »

FASTA18821,291
Isoform 6 [UniParc].

Checksum: 30E2F170A5B95C9B
Show »

FASTA879,825

References

« Hide 'large scale' references
[1]"Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases."
Saiardi A., Erdjument-Bromage H., Snowman A.M., Tempst P., Snyder S.H.
Curr. Biol. 9:1323-1326(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
[2]"Pediatric leukemia cDNA sequencing project."
Zhou J., Yu W., Tang H., Mei G., Tsang Y.T.M., Bouck J., Gibbs R.A., Margolin J.F.
Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Leukemia.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
Tissue: Brain and Uterus.
[4]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 6).
Tissue: Brain, Lung and Skin.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 76-426 (ISOFORMS 1 AND 2).
Tissue: Uterus.
[7]"Identification and characterization of a novel inositol hexakisphosphate kinase."
Saiardi A., Nagata E., Luo H.R., Snowman A.M., Snyder S.H.
J. Biol. Chem. 276:39179-39185(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF177145 mRNA. Translation: AAF15057.1.
AY007091 mRNA. Translation: AAG01984.1.
AK290526 mRNA. Translation: BAF83215.1.
AK304714 mRNA. Translation: BAG65478.1.
AC141002 Genomic DNA. No translation available.
BC001864 mRNA. No translation available.
BC004469 mRNA. Translation: AAH04469.2.
BC019694 mRNA. Translation: AAH19694.1.
BC065533 mRNA. Translation: AAH65533.1.
CA488567 mRNA. No translation available.
AL117458 mRNA. Translation: CAB55936.1.
AL137514 mRNA. Translation: CAB70780.1.
CCDSCCDS2777.1. [Q9UHH9-1]
CCDS33752.1. [Q9UHH9-2]
CCDS54579.1. [Q9UHH9-6]
CCDS54580.1. [Q9UHH9-4]
CCDS54581.1. [Q9UHH9-5]
PIRT17246.
T46275.
RefSeqNP_001005909.1. NM_001005909.2. [Q9UHH9-1]
NP_001005910.1. NM_001005910.2. [Q9UHH9-2]
NP_001005911.1. NM_001005911.2. [Q9UHH9-2]
NP_001139650.1. NM_001146178.2. [Q9UHH9-6]
NP_001139651.1. NM_001146179.2. [Q9UHH9-6]
NP_001177245.1. NM_001190316.1. [Q9UHH9-4]
NP_001177246.1. NM_001190317.1. [Q9UHH9-5]
NP_057375.2. NM_016291.3. [Q9UHH9-1]
UniGeneHs.595983.

3D structure databases

ProteinModelPortalQ9UHH9.
SMRQ9UHH9. Positions 202-422.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119546. 7 interactions.
DIPDIP-29676N.
IntActQ9UHH9. 2 interactions.
MINTMINT-1474997.
STRING9606.ENSP00000331103.

PTM databases

PhosphoSiteQ9UHH9.

Polymorphism databases

DMDM50400688.

Proteomic databases

MaxQBQ9UHH9.
PaxDbQ9UHH9.
PRIDEQ9UHH9.

Protocols and materials databases

DNASU51447.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000328631; ENSP00000331103; ENSG00000068745. [Q9UHH9-1]
ENST00000340879; ENSP00000341925; ENSG00000068745. [Q9UHH9-2]
ENST00000413298; ENSP00000396203; ENSG00000068745. [Q9UHH9-2]
ENST00000416707; ENSP00000387759; ENSG00000068745. [Q9UHH9-3]
ENST00000431721; ENSP00000414139; ENSG00000068745. [Q9UHH9-4]
ENST00000432678; ENSP00000400812; ENSG00000068745. [Q9UHH9-6]
ENST00000446860; ENSP00000399052; ENSG00000068745. [Q9UHH9-5]
GeneID51447.
KEGGhsa:51447.
UCSCuc003cup.3. human. [Q9UHH9-1]
uc003cur.3. human. [Q9UHH9-2]
uc011bbt.2. human. [Q9UHH9-4]
uc011bbv.2. human. [Q9UHH9-5]

Organism-specific databases

CTD51447.
GeneCardsGC03M048725.
HGNCHGNC:17313. IP6K2.
HPAHPA007532.
MIM606992. gene.
neXtProtNX_Q9UHH9.
PharmGKBPA164720999.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG274869.
HOVERGENHBG052140.
KOK07756.
OMAKEWVRQH.
OrthoDBEOG747PHX.
PhylomeDBQ9UHH9.
TreeFamTF314066.

Enzyme and pathway databases

BioCycMetaCyc:HS00942-MONOMER.
BRENDA2.7.4.21. 2681.
ReactomeREACT_111217. Metabolism.
REACT_6900. Immune System.

Gene expression databases

ArrayExpressQ9UHH9.
BgeeQ9UHH9.
CleanExHS_IP6K2.
GenevestigatorQ9UHH9.

Family and domain databases

InterProIPR005522. IPK.
[Graphical view]
PANTHERPTHR12400. PTHR12400. 1 hit.
PfamPF03770. IPK. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiIHPK2.
GenomeRNAi51447.
NextBio55041.
PROQ9UHH9.
SOURCESearch...

Entry information

Entry nameIP6K2_HUMAN
AccessionPrimary (citable) accession number: Q9UHH9
Secondary accession number(s): A8K3B1 expand/collapse secondary AC list , B4E3G6, G8JLL6, Q6P0N8, Q9BSZ6, Q9BUW3, Q9H4P7, Q9NT63, Q9UFU6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: July 9, 2014
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM