Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UHH9

- IP6K2_HUMAN

UniProt

Q9UHH9 - IP6K2_HUMAN

Protein

Inositol hexakisphosphate kinase 2

Gene

IP6K2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 2 (19 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.1 Publication

    Catalytic activityi

    ATP + 1D-myo-inositol hexakisphosphate = ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate.
    ATP + 1D-myo-inositol 1-diphosphate 2,3,4,5,6-pentakisphosphate = ADP + 1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate.

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. inositol-1,4,5-trisphosphate 3-kinase activity Source: InterPro
    3. inositol hexakisphosphate 1-kinase activity Source: UniProtKB-EC
    4. inositol hexakisphosphate 3-kinase activity Source: UniProtKB-EC
    5. inositol hexakisphosphate 5-kinase activity Source: UniProtKB-EC

    GO - Biological processi

    1. cytokine-mediated signaling pathway Source: Reactome
    2. inositol phosphate metabolic process Source: Reactome
    3. negative regulation of cell growth Source: UniProtKB
    4. phosphate ion transport Source: Ensembl
    5. phosphatidylinositol phosphorylation Source: UniProtKB
    6. positive regulation of apoptotic process Source: UniProtKB
    7. small molecule metabolic process Source: Reactome
    8. type I interferon signaling pathway Source: Reactome

    Keywords - Molecular functioni

    Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS00942-MONOMER.
    BRENDAi2.7.4.21. 2681.
    ReactomeiREACT_150275. Synthesis of IPs in the nucleus.
    REACT_25162. Interferon alpha/beta signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Inositol hexakisphosphate kinase 2 (EC:2.7.4.21)
    Short name:
    InsP6 kinase 2
    Alternative name(s):
    P(i)-uptake stimulator
    Short name:
    PiUS
    Gene namesi
    Name:IP6K2
    Synonyms:IHPK2
    ORF Names:TCCCIA00113
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:17313. IP6K2.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. intermediate filament cytoskeleton Source: HPA
    2. nucleoplasm Source: Reactome
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164720999.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 426426Inositol hexakisphosphate kinase 2PRO_0000066877Add
    BLAST

    Proteomic databases

    MaxQBiQ9UHH9.
    PaxDbiQ9UHH9.
    PRIDEiQ9UHH9.

    PTM databases

    PhosphoSiteiQ9UHH9.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9UHH9.
    BgeeiQ9UHH9.
    CleanExiHS_IP6K2.
    GenevestigatoriQ9UHH9.

    Organism-specific databases

    HPAiHPA007532.

    Interactioni

    Protein-protein interaction databases

    BioGridi119546. 7 interactions.
    DIPiDIP-29676N.
    IntActiQ9UHH9. 2 interactions.
    MINTiMINT-1474997.
    STRINGi9606.ENSP00000331103.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UHH9.
    SMRiQ9UHH9. Positions 202-422.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni216 – 2249Substrate bindingBy similarity

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG274869.
    HOVERGENiHBG052140.
    KOiK07756.
    OMAiKEWVRQH.
    OrthoDBiEOG747PHX.
    PhylomeDBiQ9UHH9.
    TreeFamiTF314066.

    Family and domain databases

    InterProiIPR005522. IPK.
    [Graphical view]
    PANTHERiPTHR12400. PTHR12400. 1 hit.
    PfamiPF03770. IPK. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UHH9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSPAFRAMDV EPRAKGVLLE PFVHQVGGHS CVLRFNETTL CKPLVPREHQ    50
    FYETLPAEMR KFTPQYKGVV SVRFEEDEDR NLCLIAYPLK GDHGIVDIVD 100
    NSDCEPKSKL LRWTTNKKHH VLETEKTPKD WVRQHRKEEK MKSHKLEEEF 150
    EWLKKSEVLY YTVEKKGNIS SQLKHYNPWS MKCHQQQLQR MKENAKHRNQ 200
    YKFILLENLT SRYEVPCVLD LKMGTRQHGD DASEEKAANQ IRKCQQSTSA 250
    VIGVRVCGMQ VYQAGSGQLM FMNKYHGRKL SVQGFKEALF QFFHNGRYLR 300
    RELLGPVLKK LTELKAVLER QESYRFYSSS LLVIYDGKER PEVVLDSDAE 350
    DLEDLSEESA DESAGAYAYK PIGASSVDVR MIDFAHTTCR LYGEDTVVHE 400
    GQDAGYIFGL QSLIDIVTEI SEESGE 426
    Length:426
    Mass (Da):49,186
    Last modified:July 19, 2004 - v2
    Checksum:i11BDFF12C22EECFB
    GO
    Isoform 2 (identifier: Q9UHH9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         69-97: VVSVRFEEDEDRNLCLIAYPLKGDHGIVD → QSQRPLVSWPSLPHFFPWSFPLWPQGSVA
         98-426: Missing.

    Show »
    Length:97
    Mass (Da):11,180
    Checksum:i20CD12C8CB9E4287
    GO
    Isoform 3 (identifier: Q9UHH9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         70-70: V → S
         71-426: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:70
    Mass (Da):8,004
    Checksum:iB44FEE3FD8C14391
    GO
    Isoform 4 (identifier: Q9UHH9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSLNLPEASLLSRASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
         69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
         131-426: Missing.

    Show »
    Length:185
    Mass (Da):20,924
    Checksum:iD52B5B42D42D1472
    GO
    Isoform 5 (identifier: Q9UHH9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNLCQSPFQEGCQSLLASWPEQAKEPRREGHTDKQQTEDVLAAGLRCLPHLPAICARRM
         69-130: VVSVRFEEDE...VLETEKTPKD → KSQLLEGLPH...HLTPSVFNPW
         131-426: Missing.

    Show »
    Length:188
    Mass (Da):21,291
    Checksum:i86D9872EAD7F79F6
    GO
    Isoform 6 (identifier: Q9UHH9-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         69-87: VVSVRFEEDEDRNLCLIAY → DISSHQHGGVFVGEWGSLL
         88-426: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:87
    Mass (Da):9,825
    Checksum:i30E2F170A5B95C9B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti99 – 1002VD → AH in AAF15057. (PubMed:10574768)Curated
    Sequence conflicti167 – 1671G → W in AAH65533. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSLNLPEASLLSRASWPEQA KEPRREGHTDKQQTEDVLAA GLRCLPHLPAICARRM in isoform 4. 1 PublicationVSP_042698
    Alternative sequencei1 – 11M → MNLCQSPFQEGCQSLLASWP EQAKEPRREGHTDKQQTEDV LAAGLRCLPHLPAICARRM in isoform 5. 1 PublicationVSP_042845
    Alternative sequencei69 – 13062VVSVR…KTPKD → KSQLLEGLPHWRGDVRDRGH GRPWQPSLEPSLPPTLCFPS LSSFSSSWPSAQHLTPSVFN PW in isoform 4 and isoform 5. 1 PublicationVSP_042699Add
    BLAST
    Alternative sequencei69 – 9729VVSVR…HGIVD → QSQRPLVSWPSLPHFFPWSF PLWPQGSVA in isoform 2. 2 PublicationsVSP_010925Add
    BLAST
    Alternative sequencei69 – 8719VVSVR…CLIAY → DISSHQHGGVFVGEWGSLL in isoform 6. 1 PublicationVSP_045416Add
    BLAST
    Alternative sequencei70 – 701V → S in isoform 3. 1 PublicationVSP_010926
    Alternative sequencei71 – 426356Missing in isoform 3. 1 PublicationVSP_010927Add
    BLAST
    Alternative sequencei88 – 426339Missing in isoform 6. 1 PublicationVSP_045417Add
    BLAST
    Alternative sequencei98 – 426329Missing in isoform 2. 2 PublicationsVSP_010928Add
    BLAST
    Alternative sequencei131 – 426296Missing in isoform 4 and isoform 5. 1 PublicationVSP_042700Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF177145 mRNA. Translation: AAF15057.1.
    AY007091 mRNA. Translation: AAG01984.1.
    AK290526 mRNA. Translation: BAF83215.1.
    AK304714 mRNA. Translation: BAG65478.1.
    AC141002 Genomic DNA. No translation available.
    BC001864 mRNA. No translation available.
    BC004469 mRNA. Translation: AAH04469.2.
    BC019694 mRNA. Translation: AAH19694.1.
    BC065533 mRNA. Translation: AAH65533.1.
    CA488567 mRNA. No translation available.
    AL117458 mRNA. Translation: CAB55936.1.
    AL137514 mRNA. Translation: CAB70780.1.
    CCDSiCCDS2777.1. [Q9UHH9-1]
    CCDS33752.1. [Q9UHH9-2]
    CCDS54579.1. [Q9UHH9-6]
    CCDS54580.1. [Q9UHH9-4]
    CCDS54581.1. [Q9UHH9-5]
    PIRiT17246.
    T46275.
    RefSeqiNP_001005909.1. NM_001005909.2. [Q9UHH9-1]
    NP_001005910.1. NM_001005910.2. [Q9UHH9-2]
    NP_001005911.1. NM_001005911.2. [Q9UHH9-2]
    NP_001139650.1. NM_001146178.2. [Q9UHH9-6]
    NP_001139651.1. NM_001146179.2. [Q9UHH9-6]
    NP_001177245.1. NM_001190316.1. [Q9UHH9-4]
    NP_001177246.1. NM_001190317.1. [Q9UHH9-5]
    NP_057375.2. NM_016291.3. [Q9UHH9-1]
    UniGeneiHs.595983.

    Genome annotation databases

    EnsembliENST00000328631; ENSP00000331103; ENSG00000068745. [Q9UHH9-1]
    ENST00000340879; ENSP00000341925; ENSG00000068745. [Q9UHH9-2]
    ENST00000413298; ENSP00000396203; ENSG00000068745. [Q9UHH9-2]
    ENST00000416707; ENSP00000387759; ENSG00000068745. [Q9UHH9-3]
    ENST00000431721; ENSP00000414139; ENSG00000068745. [Q9UHH9-4]
    ENST00000432678; ENSP00000400812; ENSG00000068745. [Q9UHH9-6]
    ENST00000446860; ENSP00000399052; ENSG00000068745. [Q9UHH9-5]
    GeneIDi51447.
    KEGGihsa:51447.
    UCSCiuc003cup.3. human. [Q9UHH9-1]
    uc003cur.3. human. [Q9UHH9-2]
    uc011bbt.2. human. [Q9UHH9-4]
    uc011bbv.2. human. [Q9UHH9-5]

    Polymorphism databases

    DMDMi50400688.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF177145 mRNA. Translation: AAF15057.1 .
    AY007091 mRNA. Translation: AAG01984.1 .
    AK290526 mRNA. Translation: BAF83215.1 .
    AK304714 mRNA. Translation: BAG65478.1 .
    AC141002 Genomic DNA. No translation available.
    BC001864 mRNA. No translation available.
    BC004469 mRNA. Translation: AAH04469.2 .
    BC019694 mRNA. Translation: AAH19694.1 .
    BC065533 mRNA. Translation: AAH65533.1 .
    CA488567 mRNA. No translation available.
    AL117458 mRNA. Translation: CAB55936.1 .
    AL137514 mRNA. Translation: CAB70780.1 .
    CCDSi CCDS2777.1. [Q9UHH9-1 ]
    CCDS33752.1. [Q9UHH9-2 ]
    CCDS54579.1. [Q9UHH9-6 ]
    CCDS54580.1. [Q9UHH9-4 ]
    CCDS54581.1. [Q9UHH9-5 ]
    PIRi T17246.
    T46275.
    RefSeqi NP_001005909.1. NM_001005909.2. [Q9UHH9-1 ]
    NP_001005910.1. NM_001005910.2. [Q9UHH9-2 ]
    NP_001005911.1. NM_001005911.2. [Q9UHH9-2 ]
    NP_001139650.1. NM_001146178.2. [Q9UHH9-6 ]
    NP_001139651.1. NM_001146179.2. [Q9UHH9-6 ]
    NP_001177245.1. NM_001190316.1. [Q9UHH9-4 ]
    NP_001177246.1. NM_001190317.1. [Q9UHH9-5 ]
    NP_057375.2. NM_016291.3. [Q9UHH9-1 ]
    UniGenei Hs.595983.

    3D structure databases

    ProteinModelPortali Q9UHH9.
    SMRi Q9UHH9. Positions 202-422.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119546. 7 interactions.
    DIPi DIP-29676N.
    IntActi Q9UHH9. 2 interactions.
    MINTi MINT-1474997.
    STRINGi 9606.ENSP00000331103.

    PTM databases

    PhosphoSitei Q9UHH9.

    Polymorphism databases

    DMDMi 50400688.

    Proteomic databases

    MaxQBi Q9UHH9.
    PaxDbi Q9UHH9.
    PRIDEi Q9UHH9.

    Protocols and materials databases

    DNASUi 51447.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000328631 ; ENSP00000331103 ; ENSG00000068745 . [Q9UHH9-1 ]
    ENST00000340879 ; ENSP00000341925 ; ENSG00000068745 . [Q9UHH9-2 ]
    ENST00000413298 ; ENSP00000396203 ; ENSG00000068745 . [Q9UHH9-2 ]
    ENST00000416707 ; ENSP00000387759 ; ENSG00000068745 . [Q9UHH9-3 ]
    ENST00000431721 ; ENSP00000414139 ; ENSG00000068745 . [Q9UHH9-4 ]
    ENST00000432678 ; ENSP00000400812 ; ENSG00000068745 . [Q9UHH9-6 ]
    ENST00000446860 ; ENSP00000399052 ; ENSG00000068745 . [Q9UHH9-5 ]
    GeneIDi 51447.
    KEGGi hsa:51447.
    UCSCi uc003cup.3. human. [Q9UHH9-1 ]
    uc003cur.3. human. [Q9UHH9-2 ]
    uc011bbt.2. human. [Q9UHH9-4 ]
    uc011bbv.2. human. [Q9UHH9-5 ]

    Organism-specific databases

    CTDi 51447.
    GeneCardsi GC03M048725.
    HGNCi HGNC:17313. IP6K2.
    HPAi HPA007532.
    MIMi 606992. gene.
    neXtProti NX_Q9UHH9.
    PharmGKBi PA164720999.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG274869.
    HOVERGENi HBG052140.
    KOi K07756.
    OMAi KEWVRQH.
    OrthoDBi EOG747PHX.
    PhylomeDBi Q9UHH9.
    TreeFami TF314066.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS00942-MONOMER.
    BRENDAi 2.7.4.21. 2681.
    Reactomei REACT_150275. Synthesis of IPs in the nucleus.
    REACT_25162. Interferon alpha/beta signaling.

    Miscellaneous databases

    GeneWikii IHPK2.
    GenomeRNAii 51447.
    NextBioi 55041.
    PROi Q9UHH9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UHH9.
    Bgeei Q9UHH9.
    CleanExi HS_IP6K2.
    Genevestigatori Q9UHH9.

    Family and domain databases

    InterProi IPR005522. IPK.
    [Graphical view ]
    PANTHERi PTHR12400. PTHR12400. 1 hit.
    Pfami PF03770. IPK. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases."
      Saiardi A., Erdjument-Bromage H., Snowman A.M., Tempst P., Snyder S.H.
      Curr. Biol. 9:1323-1326(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
    2. "Pediatric leukemia cDNA sequencing project."
      Zhou J., Yu W., Tang H., Mei G., Tsang Y.T.M., Bouck J., Gibbs R.A., Margolin J.F.
      Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Leukemia.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
      Tissue: Brain and Uterus.
    4. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 6).
      Tissue: Brain, Lung and Skin.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 76-426 (ISOFORMS 1 AND 2).
      Tissue: Uterus.
    7. "Identification and characterization of a novel inositol hexakisphosphate kinase."
      Saiardi A., Nagata E., Luo H.R., Snowman A.M., Snyder S.H.
      J. Biol. Chem. 276:39179-39185(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiIP6K2_HUMAN
    AccessioniPrimary (citable) accession number: Q9UHH9
    Secondary accession number(s): A8K3B1
    , B4E3G6, G8JLL6, Q6P0N8, Q9BSZ6, Q9BUW3, Q9H4P7, Q9NT63, Q9UFU6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: July 19, 2004
    Last modified: October 1, 2014
    This is version 110 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3