Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tachykinin-3

Gene

TAC3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles (By similarity). Is a critical central regulator of gonadal function.By similarity1 Publication

GO - Molecular functioni

  • receptor binding Source: ProtInc

GO - Biological processi

  • female pregnancy Source: ProtInc
  • neuropeptide signaling pathway Source: UniProtKB-KW
  • tachykinin receptor signaling pathway Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Neuropeptide

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166863-MONOMER.
ReactomeiR-HSA-380095. Tachykinin receptors bind tachykinins.
R-HSA-416476. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Tachykinin-3
Alternative name(s):
ZNEUROK1
Cleaved into the following chain:
Neurokinin-B
Short name:
NKB
Alternative name(s):
Neuromedin-K
Gene namesi
Name:TAC3
Synonyms:NKNB
ORF Names:UNQ585/PRO1155
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:11521. TAC3.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • extracellular region Source: Reactome
  • extracellular space Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

Hypogonadotropic hypogonadism 10 with or without anosmia (HH10)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by absent or incomplete sexual maturation by the age of 18 years, in conjunction with low levels of circulating gonadotropins and testosterone and no other abnormalities of the hypothalamic-pituitary axis. In some cases, it is associated with non-reproductive phenotypes, such as anosmia, cleft palate, and sensorineural hearing loss. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin-releasing hormone-synthesizing neurons. In the presence of anosmia, idiopathic hypogonadotropic hypogonadism is referred to as Kallmann syndrome, whereas in the presence of a normal sense of smell, it has been termed normosmic idiopathic hypogonadotropic hypogonadism (nIHH).
See also OMIM:614839
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06996980R → S in HH10; phenotype consistent with normosmic idiopathic hypogonadotropic hypogonadism; the patient also carries a mutation in HS6ST1. 1 PublicationCorresponds to variant rs727505372dbSNPEnsembl.1
Natural variantiVAR_06917690M → T in HH10; has markedly reduced activity. 1 PublicationCorresponds to variant rs121918123dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation, Hypogonadotropic hypogonadism

Organism-specific databases

DisGeNETi6866.
MalaCardsiTAC3.
MIMi614839. phenotype.
OpenTargetsiENSG00000166863.
Orphaneti432. Normosmic congenital hypogonadotropic hypogonadism.
PharmGKBiPA36298.

Polymorphism and mutation databases

BioMutaiTAC3.
DMDMi18203501.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
PropeptideiPRO_000003356517 – 78By similarityAdd BLAST62
PeptideiPRO_000003356681 – 90Neurokinin-B10
PropeptideiPRO_000003356794 – 121By similarityAdd BLAST28

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei90Methionine amideBy similarity1

Keywords - PTMi

Amidation, Cleavage on pair of basic residues

Proteomic databases

PaxDbiQ9UHF0.
PeptideAtlasiQ9UHF0.
PRIDEiQ9UHF0.

PTM databases

iPTMnetiQ9UHF0.
PhosphoSitePlusiQ9UHF0.

Miscellaneous databases

PMAP-CutDBQ9UHF0.

Expressioni

Developmental stagei

In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hypertension and pre-eclampsia.

Gene expression databases

BgeeiENSG00000166863.
CleanExiHS_TAC3.
ExpressionAtlasiQ9UHF0. baseline and differential.
GenevisibleiQ9UHF0. HS.

Organism-specific databases

HPAiHPA045919.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TACR3P293712EBI-6655626,EBI-6655576

GO - Molecular functioni

  • receptor binding Source: ProtInc

Protein-protein interaction databases

BioGridi112729. 8 interactors.
IntActiQ9UHF0. 7 interactors.
MINTiMINT-1381829.
STRINGi9606.ENSP00000300108.

Chemistry databases

BindingDBiQ9UHF0.

Structurei

Secondary structure

1121
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi82 – 89Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P9FNMR-A81-90[»]
ProteinModelPortaliQ9UHF0.
SMRiQ9UHF0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UHF0.

Family & Domainsi

Sequence similaritiesi

Belongs to the tachykinin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J2QH. Eukaryota.
ENOG4111D7S. LUCA.
GeneTreeiENSGT00390000000335.
HOGENOMiHOG000154597.
HOVERGENiHBG016587.
InParanoidiQ9UHF0.
KOiK05240.
OMAiKRNIQPD.
OrthoDBiEOG091G0X8Y.
PhylomeDBiQ9UHF0.
TreeFamiTF337038.

Family and domain databases

InterProiIPR003635. Neurokinin-B/TAC3.
IPR013055. Tachy_Neuro_lke_CS.
[Graphical view]
PANTHERiPTHR15536. PTHR15536. 1 hit.
PfamiPF03823. Neurokinin_B. 1 hit.
[Graphical view]
PIRSFiPIRSF001843. Neurokinin. 1 hit.
PRINTSiPR01828. NEUROKININB.
PROSITEiPS00267. TACHYKININ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UHF0-1) [UniParc]FASTAAdd to basket
Also known as: Beta tachykinin 3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRIMLLFTAI LAFSLAQSFG AVCKEPQEEV VPGGGRSKRD PDLYQLLQRL
60 70 80 90 100
FKSHSSLEGL LKALSQASTD PKESTSPEKR DMHDFFVGLM GKRSVQPDSP
110 120
TDVNQENVPS FGILKYPPRA E
Length:121
Mass (Da):13,438
Last modified:May 1, 2000 - v1
Checksum:i14C9AFE2EE9EDECA
GO
Isoform 2 (identifier: Q9UHF0-2) [UniParc]FASTAAdd to basket
Also known as: Alpha tachykinin 3

The sequence of this isoform differs from the canonical sequence as follows:
     98-121: DSPTDVNQENVPSFGILKYPPRAE → EGKTGPFLPSVRVPRPLHPNQLGSTGKSSLGTEEQRPL

Show »
Length:135
Mass (Da):14,833
Checksum:i4C6DBBDBE30851F3
GO
Isoform 3 (identifier: Q9UHF0-3) [UniParc]FASTAAdd to basket
Also known as: Gamma tachykinin 3

The sequence of this isoform differs from the canonical sequence as follows:
     80-98: RDMHDFFVGLMGKRSVQPD → H

Show »
Length:103
Mass (Da):11,358
Checksum:i2D0026B586B03FC6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti121E → D in CAG33474 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06996980R → S in HH10; phenotype consistent with normosmic idiopathic hypogonadotropic hypogonadism; the patient also carries a mutation in HS6ST1. 1 PublicationCorresponds to variant rs727505372dbSNPEnsembl.1
Natural variantiVAR_06917690M → T in HH10; has markedly reduced activity. 1 PublicationCorresponds to variant rs121918123dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01318680 – 98RDMHD…SVQPD → H in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_01318798 – 121DSPTD…PPRAE → EGKTGPFLPSVRVPRPLHPN QLGSTGKSSLGTEEQRPL in isoform 2. 2 PublicationsAdd BLAST24

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186112 mRNA. Translation: AAF01430.1.
AF216586 mRNA. Translation: AAF76980.1.
AF537113 mRNA. Translation: AAQ10783.1.
AF537114 mRNA. Translation: AAQ10784.1.
AF537115 mRNA. Translation: AAQ10785.1.
AF537116 mRNA. Translation: AAQ10786.1.
AF537117 mRNA. Translation: AAQ10787.1.
AF537118 mRNA. Translation: AAQ10788.1.
AF537119 mRNA. Translation: AAQ10789.1.
AF537120 mRNA. Translation: AAQ10790.1.
AF537121 mRNA. Translation: AAQ10791.1.
AY358679 mRNA. Translation: AAQ89042.1.
CR457193 mRNA. Translation: CAG33474.1.
BC032145 mRNA. Translation: AAH32145.1.
CCDSiCCDS53803.1. [Q9UHF0-3]
CCDS8928.1. [Q9UHF0-1]
RefSeqiNP_001171525.1. NM_001178054.1. [Q9UHF0-3]
NP_037383.1. NM_013251.3. [Q9UHF0-1]
UniGeneiHs.9730.

Genome annotation databases

EnsembliENST00000300108; ENSP00000300108; ENSG00000166863. [Q9UHF0-1]
ENST00000357616; ENSP00000350236; ENSG00000166863. [Q9UHF0-2]
ENST00000379411; ENSP00000368721; ENSG00000166863. [Q9UHF0-3]
ENST00000393867; ENSP00000377445; ENSG00000166863. [Q9UHF0-2]
ENST00000415231; ENSP00000402995; ENSG00000166863. [Q9UHF0-1]
ENST00000423597; ENSP00000416292; ENSG00000166863. [Q9UHF0-3]
ENST00000438756; ENSP00000408131; ENSG00000166863. [Q9UHF0-2]
ENST00000441881; ENSP00000408208; ENSG00000166863. [Q9UHF0-3]
ENST00000458521; ENSP00000404056; ENSG00000166863. [Q9UHF0-1]
ENST00000615887; ENSP00000483110; ENSG00000166863. [Q9UHF0-1]
GeneIDi6866.
KEGGihsa:6866.
UCSCiuc001smo.4. human. [Q9UHF0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF186112 mRNA. Translation: AAF01430.1.
AF216586 mRNA. Translation: AAF76980.1.
AF537113 mRNA. Translation: AAQ10783.1.
AF537114 mRNA. Translation: AAQ10784.1.
AF537115 mRNA. Translation: AAQ10785.1.
AF537116 mRNA. Translation: AAQ10786.1.
AF537117 mRNA. Translation: AAQ10787.1.
AF537118 mRNA. Translation: AAQ10788.1.
AF537119 mRNA. Translation: AAQ10789.1.
AF537120 mRNA. Translation: AAQ10790.1.
AF537121 mRNA. Translation: AAQ10791.1.
AY358679 mRNA. Translation: AAQ89042.1.
CR457193 mRNA. Translation: CAG33474.1.
BC032145 mRNA. Translation: AAH32145.1.
CCDSiCCDS53803.1. [Q9UHF0-3]
CCDS8928.1. [Q9UHF0-1]
RefSeqiNP_001171525.1. NM_001178054.1. [Q9UHF0-3]
NP_037383.1. NM_013251.3. [Q9UHF0-1]
UniGeneiHs.9730.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P9FNMR-A81-90[»]
ProteinModelPortaliQ9UHF0.
SMRiQ9UHF0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112729. 8 interactors.
IntActiQ9UHF0. 7 interactors.
MINTiMINT-1381829.
STRINGi9606.ENSP00000300108.

Chemistry databases

BindingDBiQ9UHF0.

PTM databases

iPTMnetiQ9UHF0.
PhosphoSitePlusiQ9UHF0.

Polymorphism and mutation databases

BioMutaiTAC3.
DMDMi18203501.

Proteomic databases

PaxDbiQ9UHF0.
PeptideAtlasiQ9UHF0.
PRIDEiQ9UHF0.

Protocols and materials databases

DNASUi6866.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300108; ENSP00000300108; ENSG00000166863. [Q9UHF0-1]
ENST00000357616; ENSP00000350236; ENSG00000166863. [Q9UHF0-2]
ENST00000379411; ENSP00000368721; ENSG00000166863. [Q9UHF0-3]
ENST00000393867; ENSP00000377445; ENSG00000166863. [Q9UHF0-2]
ENST00000415231; ENSP00000402995; ENSG00000166863. [Q9UHF0-1]
ENST00000423597; ENSP00000416292; ENSG00000166863. [Q9UHF0-3]
ENST00000438756; ENSP00000408131; ENSG00000166863. [Q9UHF0-2]
ENST00000441881; ENSP00000408208; ENSG00000166863. [Q9UHF0-3]
ENST00000458521; ENSP00000404056; ENSG00000166863. [Q9UHF0-1]
ENST00000615887; ENSP00000483110; ENSG00000166863. [Q9UHF0-1]
GeneIDi6866.
KEGGihsa:6866.
UCSCiuc001smo.4. human. [Q9UHF0-1]

Organism-specific databases

CTDi6866.
DisGeNETi6866.
GeneCardsiTAC3.
H-InvDBHIX0010742.
HGNCiHGNC:11521. TAC3.
HPAiHPA045919.
MalaCardsiTAC3.
MIMi162330. gene.
614839. phenotype.
neXtProtiNX_Q9UHF0.
OpenTargetsiENSG00000166863.
Orphaneti432. Normosmic congenital hypogonadotropic hypogonadism.
PharmGKBiPA36298.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2QH. Eukaryota.
ENOG4111D7S. LUCA.
GeneTreeiENSGT00390000000335.
HOGENOMiHOG000154597.
HOVERGENiHBG016587.
InParanoidiQ9UHF0.
KOiK05240.
OMAiKRNIQPD.
OrthoDBiEOG091G0X8Y.
PhylomeDBiQ9UHF0.
TreeFamiTF337038.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000166863-MONOMER.
ReactomeiR-HSA-380095. Tachykinin receptors bind tachykinins.
R-HSA-416476. G alpha (q) signalling events.

Miscellaneous databases

EvolutionaryTraceiQ9UHF0.
GeneWikiiTAC3.
GenomeRNAii6866.
PMAP-CutDBQ9UHF0.
PROiQ9UHF0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166863.
CleanExiHS_TAC3.
ExpressionAtlasiQ9UHF0. baseline and differential.
GenevisibleiQ9UHF0. HS.

Family and domain databases

InterProiIPR003635. Neurokinin-B/TAC3.
IPR013055. Tachy_Neuro_lke_CS.
[Graphical view]
PANTHERiPTHR15536. PTHR15536. 1 hit.
PfamiPF03823. Neurokinin_B. 1 hit.
[Graphical view]
PIRSFiPIRSF001843. Neurokinin. 1 hit.
PRINTSiPR01828. NEUROKININB.
PROSITEiPS00267. TACHYKININ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTKNK_HUMAN
AccessioniPrimary (citable) accession number: Q9UHF0
Secondary accession number(s): Q6IAG2, Q71BC6, Q71BC9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 139 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.