Q9UHF0 (TKNK_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tachykinin-3 Alternative name(s): ZNEUROK1 Cleaved into the following chain:
| ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 121 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles By similarity. |
| Subcellular location | |
| Developmental stage | In pregnancy, the expression of NKB is confined to the outer syncytiotrophoblast of the placenta, significant concentrations of NKB can be detected in plasma as early as week 9, and plasma concentrations of NKB are grossly elevated in pregnancy-induced hypertension and pre-eclampsia. |
| Sequence similarities | Belongs to the tachykinin family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Neuropeptide |
| PTM | Amidation Cleavage on pair of basic residues |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | female pregnancy Traceable author statement. Source: ProtInc neuropeptide signaling pathwayInferred from electronic annotation. Source: UniProtKB-KW tachykinin receptor signaling pathwayTraceable author statement. Source: ProtInc |
| Cellular component | extracellular space Traceable author statement. Source: ProtInc soluble fractionTraceable author statement. Source: ProtInc |
| Molecular function | receptor binding Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UHF0-1) Also known as: Beta tachykinin 3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UHF0-2) Also known as: Alpha tachykinin 3; The sequence of this isoform differs from the canonical sequence as follows: 98-121: DSPTDVNQENVPSFGILKYPPRAE → EGKTGPFLPSVRVPRPLHPNQLGSTGKSSLGTEEQRPL | ||||||
| Isoform 3 (identifier: Q9UHF0-3) Also known as: Gamma tachykinin 3; The sequence of this isoform differs from the canonical sequence as follows: 80-98: RDMHDFFVGLMGKRSVQPD → H |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Propeptide | 17 – 78 | 62 | By similarity | PRO_0000033565 | |||||||
| Peptide | 81 – 90 | 10 | Neurokinin-B | PRO_0000033566 | |||||||
| Propeptide | 94 – 121 | 28 | By similarity | PRO_0000033567 | |||||||
Amino acid modifications | |||||||||||
| Modified residue | 90 | 1 | Methionine amide By similarity | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 80 – 98 | 19 | RDMHD…SVQPD → H in isoform 3. | VSP_013186 | |||||||
| Alternative sequence | 98 – 121 | 24 | DSPTD…PPRAE → EGKTGPFLPSVRVPRPLHPN QLGSTGKSSLGTEEQRPL in isoform 2. | VSP_013187 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 121 | 1 | E → D in CAG33474. Ref.5 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 82 – 89 | 8 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Sheppard P., Jelinek L., Whitmore T., Blumberg H., Lehner J., O'Hara P. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Excessive placental secretion of neurokinin B during the third trimester causes pre-eclampsia." Page N.M., Woods R.J., Gardiner S.M., Lomthiasong K., Gladwell R.T., Butlin D.J., Manyonda I.T., Lowry P.J. Nature 405:797-800(2000) [PubMed: 10866201] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. |
| [3] | "The peripheral expression of neurokinin B, its splice variants and its receptors." Bell N.J., Page N.M. Submitted (AUG-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF186112 mRNA. Translation: AAF01430.1. AF216586 mRNA. Translation: AAF76980.1. AF537113 mRNA. Translation: AAQ10783.1. AF537114 mRNA. Translation: AAQ10784.1. AF537115 mRNA. Translation: AAQ10785.1. AF537116 mRNA. Translation: AAQ10786.1. AF537117 mRNA. Translation: AAQ10787.1. AF537118 mRNA. Translation: AAQ10788.1. AF537119 mRNA. Translation: AAQ10789.1. AF537120 mRNA. Translation: AAQ10790.1. AF537121 mRNA. Translation: AAQ10791.1. AY358679 mRNA. Translation: AAQ89042.1. CR457193 mRNA. Translation: CAG33474.1. BC032145 mRNA. Translation: AAH32145.1. | ||||||||||||
| IPI | IPI00001674. IPI00431183. IPI00554743. | ||||||||||||
| RefSeq | NP_001171525.1. NM_001178054.1. NP_037383.1. NM_013251.3. | ||||||||||||
| UniGene | Hs.9730. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UHF0. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9UHF0. 6 interactions. | ||||||||||||
| MINT | MINT-1381829. | ||||||||||||
| STRING | Q9UHF0. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 18203501. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9UHF0. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000300108; ENSP00000300108; ENSG00000166863. ENST00000415231; ENSP00000402995; ENSG00000166863. ENST00000458521; ENSP00000404056; ENSG00000166863. | ||||||||||||
| GeneID | 6866. | ||||||||||||
| KEGG | hsa:6866. | ||||||||||||
| UCSC | uc001smm.1. human. uc001smn.1. human. uc001smo.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 6866. | ||||||||||||
| GeneCards | GC12M057403. | ||||||||||||
| H-InvDB | HIX0010742. | ||||||||||||
| HGNC | HGNC:11521. TAC3. | ||||||||||||
| HPA | HPA045919. | ||||||||||||
| MIM | 162330. gene. | ||||||||||||
| neXtProt | NX_Q9UHF0. | ||||||||||||
| Orphanet | 432. Normosmic congenital hypogonadotropic hypogonadism. | ||||||||||||
| PharmGKB | PA36298. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000000335. | ||||||||||||
| HOVERGEN | HBG016587. | ||||||||||||
| OMA | TDVNQEN. | ||||||||||||
| OrthoDB | EOG4HDSW3. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UHF0. | ||||||||||||
| Bgee | Q9UHF0. | ||||||||||||
| CleanEx | HS_TAC3. | ||||||||||||
| Genevestigator | Q9UHF0. | ||||||||||||
| GermOnline | ENSG00000166863. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR003635. Neurokinin. IPR013055. Tachy_Neuro_lke_CS. [Graphical view] | ||||||||||||
| KO | K05240. | ||||||||||||
| PANTHER | PTHR15536. Neurokinin. 1 hit. | ||||||||||||
| Pfam | PF03823. Neurokinin_B. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF001843. Neurokinin. 1 hit. | ||||||||||||
| PRINTS | PR01828. NEUROKININB. | ||||||||||||
| PROSITE | PS00267. TACHYKININ. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 26797. | ||||||||||||
| PMAP-CutDB | Q9UHF0. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | TKNK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UHF0 Secondary accession number(s): Q6IAG2, Q71BC6, Q71BC9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with