Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-19

Gene

IL19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis (By similarity).By similarity

GO - Molecular functioni

  • cytokine activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000142224-MONOMER.
ReactomeiR-HSA-8854691. Interleukin-19, 20, 22, 24.
SignaLinkiQ9UHD0.
SIGNORiQ9UHD0.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-19
Short name:
IL-19
Alternative name(s):
Melanoma differentiation-associated protein-like protein
NG.1
Gene namesi
Name:IL19
Synonyms:ZMDA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:5990. IL19.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: UniProtKB
  • extracellular space Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi29949.
OpenTargetsiENSG00000142224.
PharmGKBiPA29806.

Polymorphism and mutation databases

BioMutaiIL19.
DMDMi146345440.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 241 PublicationAdd BLAST24
ChainiPRO_000001537925 – 177Interleukin-19Add BLAST153

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi28 ↔ 1211 Publication
Glycosylationi56N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi75 ↔ 1271 Publication
Disulfide bondi76 ↔ 1291 Publication
Glycosylationi135N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9UHD0.
PeptideAtlasiQ9UHD0.
PRIDEiQ9UHD0.

Expressioni

Gene expression databases

BgeeiENSG00000142224.
CleanExiHS_IL19.
GenevisibleiQ9UHD0. HS.

Organism-specific databases

HPAiCAB023801.

Interactioni

GO - Molecular functioni

  • cytokine activity Source: UniProtKB

Protein-protein interaction databases

STRINGi9606.ENSP00000343000.

Structurei

Secondary structure

1177
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi23 – 26Combined sources4
Turni28 – 31Combined sources4
Helixi34 – 49Combined sources16
Helixi61 – 64Combined sources4
Beta strandi65 – 67Combined sources3
Helixi71 – 87Combined sources17
Helixi89 – 92Combined sources4
Helixi98 – 121Combined sources24
Helixi131 – 146Combined sources16
Helixi149 – 158Combined sources10
Helixi160 – 170Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1N1FX-ray1.95A19-177[»]
ProteinModelPortaliQ9UHD0.
SMRiQ9UHD0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UHD0.

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-10 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IWQW. Eukaryota.
ENOG41115RG. LUCA.
GeneTreeiENSGT00410000025637.
HOGENOMiHOG000113033.
HOVERGENiHBG108002.
InParanoidiQ9UHD0.
KOiK05444.
OMAiLDVFLAW.
OrthoDBiEOG091G0Q0Q.
PhylomeDBiQ9UHD0.
TreeFamiTF333253.

Family and domain databases

Gene3Di1.20.1250.10. 1 hit.
InterProiIPR009079. 4_helix_cytokine-like_core.
IPR012351. 4_helix_cytokine_core.
IPR020443. IL-10/19/20/22/24/26_fam.
IPR020423. IL-10_CS.
IPR020421. IL-19.
[Graphical view]
PANTHERiPTHR11585. PTHR11585. 1 hit.
PfamiPF00726. IL10. 1 hit.
[Graphical view]
PRINTSiPR01934. INTRLEUKIN19.
SUPFAMiSSF47266. SSF47266. 1 hit.
PROSITEiPS00520. INTERLEUKIN_10. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UHD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLQCVSLWL LGTILILCSV DNHGLRRCLI STDMHHIEES FQEIKRAIQA
60 70 80 90 100
KDTFPNVTIL STLETLQIIK PLDVCCVTKN LLAFYVDRVF KDHQEPNPKI
110 120 130 140 150
LRKISSIANS FLYMQKTLRQ CQEQRQCHCR QEATNATRVI HDNYDQLEVH
160 170
AAAIKSLGEL DVFLAWINKN HEVMFSA
Length:177
Mass (Da):20,452
Last modified:May 1, 2007 - v2
Checksum:i7CCFB052177DE408
GO
Isoform 2 (identifier: Q9UHD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM

Show »
Length:215
Mass (Da):24,568
Checksum:iD79D6B0F11DA74E4
GO
Isoform 3 (identifier: Q9UHD0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     122-177: QEQRQCHCRQ...NKNHEVMFSA → VSHWVRIPAS...GVTNLCQHIP

Show »
Length:207
Mass (Da):23,079
Checksum:iAFDEA5767BFF9784
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013077175F → S.4 PublicationsCorresponds to variant rs2243191dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0462531M → MCTEGAFPHRSACSLPLTHV HTHIHVCVPVLWGSVPRGM in isoform 2. 1 Publication1
Alternative sequenceiVSP_057193122 – 177QEQRQ…VMFSA → VSHWVRIPASAPCLPKERPG SAGPHRPPDMVLGVKGNSLR TSTGRTVENLSQWPLLPQGS LPADNSSDGLLLDNPPGVTN LCQHIP in isoform 3. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF276915 Genomic DNA. Translation: AAG16755.1.
AY040367 mRNA. Translation: AAK91776.1.
AF453946 mRNA. Translation: AAN40906.1.
FJ380053 mRNA. Translation: ACJ06540.1.
AF192498 mRNA. Translation: AAF06663.1.
AF390905 Genomic DNA. Translation: AAK64498.1.
AL513315 Genomic DNA. Translation: CAH71814.1.
AL049615 Genomic DNA. Translation: CAB72342.1.
CCDSiCCDS1468.1. [Q9UHD0-2]
CCDS1469.1. [Q9UHD0-1]
RefSeqiNP_037503.2. NM_013371.3. [Q9UHD0-1]
NP_715639.1. NM_153758.2. [Q9UHD0-2]
XP_011507752.1. XM_011509450.2. [Q9UHD0-3]
UniGeneiHs.661017.

Genome annotation databases

EnsembliENST00000270218; ENSP00000270218; ENSG00000142224. [Q9UHD0-1]
ENST00000340758; ENSP00000343000; ENSG00000142224. [Q9UHD0-2]
ENST00000620365; ENSP00000482668; ENSG00000142224. [Q9UHD0-1]
GeneIDi29949.
KEGGihsa:29949.
UCSCiuc001heo.3. human. [Q9UHD0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF276915 Genomic DNA. Translation: AAG16755.1.
AY040367 mRNA. Translation: AAK91776.1.
AF453946 mRNA. Translation: AAN40906.1.
FJ380053 mRNA. Translation: ACJ06540.1.
AF192498 mRNA. Translation: AAF06663.1.
AF390905 Genomic DNA. Translation: AAK64498.1.
AL513315 Genomic DNA. Translation: CAH71814.1.
AL049615 Genomic DNA. Translation: CAB72342.1.
CCDSiCCDS1468.1. [Q9UHD0-2]
CCDS1469.1. [Q9UHD0-1]
RefSeqiNP_037503.2. NM_013371.3. [Q9UHD0-1]
NP_715639.1. NM_153758.2. [Q9UHD0-2]
XP_011507752.1. XM_011509450.2. [Q9UHD0-3]
UniGeneiHs.661017.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1N1FX-ray1.95A19-177[»]
ProteinModelPortaliQ9UHD0.
SMRiQ9UHD0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000343000.

Polymorphism and mutation databases

BioMutaiIL19.
DMDMi146345440.

Proteomic databases

PaxDbiQ9UHD0.
PeptideAtlasiQ9UHD0.
PRIDEiQ9UHD0.

Protocols and materials databases

DNASUi29949.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000270218; ENSP00000270218; ENSG00000142224. [Q9UHD0-1]
ENST00000340758; ENSP00000343000; ENSG00000142224. [Q9UHD0-2]
ENST00000620365; ENSP00000482668; ENSG00000142224. [Q9UHD0-1]
GeneIDi29949.
KEGGihsa:29949.
UCSCiuc001heo.3. human. [Q9UHD0-1]

Organism-specific databases

CTDi29949.
DisGeNETi29949.
GeneCardsiIL19.
HGNCiHGNC:5990. IL19.
HPAiCAB023801.
MIMi605687. gene.
neXtProtiNX_Q9UHD0.
OpenTargetsiENSG00000142224.
PharmGKBiPA29806.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWQW. Eukaryota.
ENOG41115RG. LUCA.
GeneTreeiENSGT00410000025637.
HOGENOMiHOG000113033.
HOVERGENiHBG108002.
InParanoidiQ9UHD0.
KOiK05444.
OMAiLDVFLAW.
OrthoDBiEOG091G0Q0Q.
PhylomeDBiQ9UHD0.
TreeFamiTF333253.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000142224-MONOMER.
ReactomeiR-HSA-8854691. Interleukin-19, 20, 22, 24.
SignaLinkiQ9UHD0.
SIGNORiQ9UHD0.

Miscellaneous databases

EvolutionaryTraceiQ9UHD0.
GenomeRNAii29949.
PROiQ9UHD0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142224.
CleanExiHS_IL19.
GenevisibleiQ9UHD0. HS.

Family and domain databases

Gene3Di1.20.1250.10. 1 hit.
InterProiIPR009079. 4_helix_cytokine-like_core.
IPR012351. 4_helix_cytokine_core.
IPR020443. IL-10/19/20/22/24/26_fam.
IPR020423. IL-10_CS.
IPR020421. IL-19.
[Graphical view]
PANTHERiPTHR11585. PTHR11585. 1 hit.
PfamiPF00726. IL10. 1 hit.
[Graphical view]
PRINTSiPR01934. INTRLEUKIN19.
SUPFAMiSSF47266. SSF47266. 1 hit.
PROSITEiPS00520. INTERLEUKIN_10. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIL19_HUMAN
AccessioniPrimary (citable) accession number: Q9UHD0
Secondary accession number(s): B6VEV9
, Q5VUT3, Q96QR4, Q9NUA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2007
Last modified: November 2, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.