Q9UHD0 (IL19_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-19 Short name=IL-19 Alternative name(s): Melanoma differentiation-associated protein-like protein NG.1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 177 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the IL-10 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Molecular function | Cytokine |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | apoptotic process Inferred from electronic annotation. Source: UniProtKB-KW immune responseNon-traceable author statement Ref.1. Source: UniProtKB signal transductionNon-traceable author statement Ref.1. Source: UniProtKB |
| Cellular_component | extracellular region Non-traceable author statement Ref.1. Source: UniProtKB extracellular spaceInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | cytokine activity Traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UHD0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UHD0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Ref.6 | |||||||||||||||||||||||||||
| Chain | 25 – 177 | 153 | Interleukin-19 | PRO_0000015379 | ||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Glycosylation | 56 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Glycosylation | 135 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||
| Disulfide bond | 28 ↔ 121 | Ref.7 | ||||||||||||||||||||||||||||
| Disulfide bond | 75 ↔ 127 | Ref.7 | ||||||||||||||||||||||||||||
| Disulfide bond | 76 ↔ 129 | Ref.7 | ||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MCTEGAFPHRSACSLPLTHV HTHIHVCVPVLWGSVPRGM in isoform 2. | VSP_046253 | ||||||||||||||||||||||||||
| Natural variant | 175 | 1 | F → S. Ref.1 Ref.2 Ref.3 Ref.4 Corresponds to variant rs2243191 [ dbSNP | Ensembl ]. | VAR_013077 | ||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Helix | 23 – 26 | 4 | ||||||||||||||||||||||||||||
| Turn | 28 – 31 | 4 | ||||||||||||||||||||||||||||
| Helix | 34 – 49 | 16 | ||||||||||||||||||||||||||||
| Helix | 61 – 64 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 65 – 67 | 3 | ||||||||||||||||||||||||||||
| Helix | 71 – 87 | 17 | ||||||||||||||||||||||||||||
| Helix | 89 – 92 | 4 | ||||||||||||||||||||||||||||
| Helix | 98 – 121 | 24 | ||||||||||||||||||||||||||||
| Helix | 131 – 146 | 16 | ||||||||||||||||||||||||||||
| Helix | 149 – 158 | 10 | ||||||||||||||||||||||||||||
| Helix | 160 – 170 | 11 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homolog of human interleukin-10 (IL-10)." Gallagher G., Dickensheets H., Eskdale J., Izotova L.S., Mirochnitchenko O.V., Peat J.D., Vasquez N., Pestka S., Donnelly R.P., Kotenko S.V. Genes Immun. 1:442-450(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT SER-175. |
| [2] | "IL-19 induces production of IL-6 and TNF-alpha and results in cell apoptosis through TNF-alpha." Liao Y.-C., Liang W.G., Chen F.W., Hsu J.H., Yang J.J., Chang M.-S. J. Immunol. 169:4288-4297(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175. |
| [3] | "Homo sapiens homolog of melanoma differentiation associated gene." Conklin D., Petersen J., Loften-Day C., Whitmore T., Muerer M., Sexson S., Smith D., Lok S., Pownder T., O'Hara P. Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175. |
| [4] | SeattleSNPs variation discovery resource Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-175. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 25-39. |
| [7] | "Crystal structure of interleukin-19 defines a new subfamily of helical cytokines." Chang C., Magracheva E., Kozlov S., Fong S., Tobin G., Kotenko S., Wlodawer A., Zdanov A. J. Biol. Chem. 278:3308-3313(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 19-177, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF276915 Genomic DNA. Translation: AAG16755.1. AY040367 mRNA. Translation: AAK91776.1. AF453946 mRNA. Translation: AAN40906.1. AF192498 mRNA. Translation: AAF06663.1. AF390905 Genomic DNA. Translation: AAK64498.1. AL513315 Genomic DNA. Translation: CAH71814.1. AL049615 Genomic DNA. Translation: CAB72342.1. | ||||||||||||
| IPI | IPI00028480. IPI00376786. | ||||||||||||
| RefSeq | NP_037503.2. NM_013371.3. NP_715639.1. NM_153758.2. | ||||||||||||
| UniGene | Hs.661017. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UHD0. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000343000. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UHD0. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 146345440. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9UHD0. | ||||||||||||
| PRIDE | Q9UHD0. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 29949. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000270218; ENSP00000270218; ENSG00000142224. ENST00000340758; ENSP00000343000; ENSG00000142224. | ||||||||||||
| GeneID | 29949. | ||||||||||||
| KEGG | hsa:29949. | ||||||||||||
| UCSC | uc001hep.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 29949. | ||||||||||||
| GeneCards | GC01P206972. | ||||||||||||
| HGNC | HGNC:5990. IL19. | ||||||||||||
| MIM | 605687. gene. | ||||||||||||
| neXtProt | NX_Q9UHD0. | ||||||||||||
| PharmGKB | PA29806. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG26818. | ||||||||||||
| HOGENOM | HOG000113033. | ||||||||||||
| HOVERGEN | HBG108002. | ||||||||||||
| InParanoid | Q9UHD0. | ||||||||||||
| KO | K05444. | ||||||||||||
| OrthoDB | EOG4XWG07. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | il23pathway. IL23-mediated signaling events. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UHD0. | ||||||||||||
| Bgee | Q9UHD0. | ||||||||||||
| CleanEx | HS_IL19. | ||||||||||||
| Genevestigator | Q9UHD0. | ||||||||||||
| GermOnline | ENSG00000142224. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.1250.10. 1 hit. | ||||||||||||
| InterPro | IPR009079. 4_helix_cytokine-like_core. IPR012351. 4_helix_cytokine_core. IPR020443. Interleukin-10/19/20/24. IPR020423. Interleukin-10_CS. IPR020421. Interleukin-19. [Graphical view] | ||||||||||||
| PANTHER | PTHR11585. PTHR11585. 1 hit. | ||||||||||||
| Pfam | PF00726. IL10. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01934. INTRLEUKIN19. | ||||||||||||
| SMART | SM00188. IL10. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47266. 4_helix_cytokine. 1 hit. | ||||||||||||
| PROSITE | PS00520. INTERLEUKIN_10. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9UHD0. | ||||||||||||
| GenomeRNAi | 29949. | ||||||||||||
| NextBio | 52635. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | IL19_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UHD0 Secondary accession number(s): Q5VUT3, Q96QR4, Q9NUA0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
