Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UHD0 (IL19_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 120. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Interleukin-19

Short name=IL-19
Alternative name(s):
Melanoma differentiation-associated protein-like protein
NG.1
Gene names
Name:IL19
Synonyms:ZMDA1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length177 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis By similarity.

Subcellular location

Secreted.

Sequence similarities

Belongs to the IL-10 family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9UHD0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9UHD0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Ref.6
Chain25 – 177153Interleukin-19
PRO_0000015379

Amino acid modifications

Glycosylation561N-linked (GlcNAc...) Potential
Glycosylation1351N-linked (GlcNAc...) Potential
Disulfide bond28 ↔ 121 Ref.7
Disulfide bond75 ↔ 127 Ref.7
Disulfide bond76 ↔ 129 Ref.7

Natural variations

Alternative sequence11M → MCTEGAFPHRSACSLPLTHV HTHIHVCVPVLWGSVPRGM in isoform 2.
VSP_046253
Natural variant1751F → S. Ref.1 Ref.2 Ref.3 Ref.4
Corresponds to variant rs2243191 [ dbSNP | Ensembl ].
VAR_013077

Secondary structure

...................... 177
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 2007. Version 2.
Checksum: 7CCFB052177DE408

FASTA17720,452
        10         20         30         40         50         60 
MKLQCVSLWL LGTILILCSV DNHGLRRCLI STDMHHIEES FQEIKRAIQA KDTFPNVTIL 

        70         80         90        100        110        120 
STLETLQIIK PLDVCCVTKN LLAFYVDRVF KDHQEPNPKI LRKISSIANS FLYMQKTLRQ 

       130        140        150        160        170 
CQEQRQCHCR QEATNATRVI HDNYDQLEVH AAAIKSLGEL DVFLAWINKN HEVMFSA 

« Hide

Isoform 2 [UniParc].

Checksum: D79D6B0F11DA74E4
Show »

FASTA21524,568

References

« Hide 'large scale' references
[1]"Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homolog of human interleukin-10 (IL-10)."
Gallagher G., Dickensheets H., Eskdale J., Izotova L.S., Mirochnitchenko O.V., Peat J.D., Vasquez N., Pestka S., Donnelly R.P., Kotenko S.V.
Genes Immun. 1:442-450(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT SER-175.
[2]"IL-19 induces production of IL-6 and TNF-alpha and results in cell apoptosis through TNF-alpha."
Liao Y.-C., Liang W.G., Chen F.W., Hsu J.H., Yang J.J., Chang M.-S.
J. Immunol. 169:4288-4297(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175.
[3]"Homo sapiens homolog of melanoma differentiation associated gene."
Conklin D., Petersen J., Loften-Day C., Whitmore T., Muerer M., Sexson S., Smith D., Lok S., Pownder T., O'Hara P.
Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175.
[4]SeattleSNPs variation discovery resource
Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-175.
[5]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 25-39.
[7]"Crystal structure of interleukin-19 defines a new subfamily of helical cytokines."
Chang C., Magracheva E., Kozlov S., Fong S., Tobin G., Kotenko S., Wlodawer A., Zdanov A.
J. Biol. Chem. 278:3308-3313(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 19-177, DISULFIDE BONDS.
+Additional computationally mapped references.

Web resources

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF276915 Genomic DNA. Translation: AAG16755.1.
AY040367 mRNA. Translation: AAK91776.1.
AF453946 mRNA. Translation: AAN40906.1.
AF192498 mRNA. Translation: AAF06663.1.
AF390905 Genomic DNA. Translation: AAK64498.1.
AL513315 Genomic DNA. Translation: CAH71814.1.
AL049615 Genomic DNA. Translation: CAB72342.1.
RefSeqNP_037503.2. NM_013371.3.
NP_715639.1. NM_153758.2.
UniGeneHs.661017.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1N1FX-ray1.95A19-177[»]
ProteinModelPortalQ9UHD0.
SMRQ9UHD0. Positions 22-177.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000343000.

PTM databases

PhosphoSiteQ9UHD0.

Polymorphism databases

DMDM146345440.

Proteomic databases

PaxDbQ9UHD0.
PRIDEQ9UHD0.

Protocols and materials databases

DNASU29949.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000270218; ENSP00000270218; ENSG00000142224. [Q9UHD0-1]
ENST00000340758; ENSP00000343000; ENSG00000142224. [Q9UHD0-2]
GeneID29949.
KEGGhsa:29949.
UCSCuc001hep.3. human. [Q9UHD0-1]

Organism-specific databases

CTD29949.
GeneCardsGC01P206972.
HGNCHGNC:5990. IL19.
MIM605687. gene.
neXtProtNX_Q9UHD0.
PharmGKBPA29806.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG26818.
HOGENOMHOG000113033.
HOVERGENHBG108002.
InParanoidQ9UHD0.
KOK05444.
OMALDVFLAW.
OrthoDBEOG7060SK.
PhylomeDBQ9UHD0.
TreeFamTF333253.

Enzyme and pathway databases

SignaLinkQ9UHD0.

Gene expression databases

BgeeQ9UHD0.
CleanExHS_IL19.
GenevestigatorQ9UHD0.

Family and domain databases

Gene3D1.20.1250.10. 1 hit.
InterProIPR009079. 4_helix_cytokine-like_core.
IPR012351. 4_helix_cytokine_core.
IPR020443. IL-10/19/20/24/26_fam.
IPR020423. IL-10_CS.
IPR020421. IL-19.
[Graphical view]
PANTHERPTHR11585. PTHR11585. 1 hit.
PfamPF00726. IL10. 1 hit.
[Graphical view]
PRINTSPR01934. INTRLEUKIN19.
SMARTSM00188. IL10. 1 hit.
[Graphical view]
SUPFAMSSF47266. SSF47266. 1 hit.
PROSITEPS00520. INTERLEUKIN_10. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9UHD0.
GenomeRNAi29949.
NextBio52635.
PROQ9UHD0.
SOURCESearch...

Entry information

Entry nameIL19_HUMAN
AccessionPrimary (citable) accession number: Q9UHD0
Secondary accession number(s): Q5VUT3, Q96QR4, Q9NUA0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2007
Last modified: April 16, 2014
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM