Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UHD0

- IL19_HUMAN

UniProt

Q9UHD0 - IL19_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Interleukin-19

Gene

IL19

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis (By similarity).By similarity

GO - Molecular functioni

  1. cytokine activity Source: UniProtKB

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. immune response Source: UniProtKB
  3. interleukin-6 biosynthetic process Source: Ensembl
  4. negative regulation of extrinsic apoptotic signaling pathway Source: Ensembl
  5. positive regulation of intrinsic apoptotic signaling pathway Source: Ensembl
  6. reactive oxygen species metabolic process Source: Ensembl
  7. signal transduction Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

SignaLinkiQ9UHD0.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-19
Short name:
IL-19
Alternative name(s):
Melanoma differentiation-associated protein-like protein
NG.1
Gene namesi
Name:IL19
Synonyms:ZMDA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:5990. IL19.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB
  2. extracellular space Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29806.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 24241 PublicationAdd
BLAST
Chaini25 – 177153Interleukin-19PRO_0000015379Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi28 ↔ 1211 Publication
Glycosylationi56 – 561N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi75 ↔ 1271 Publication
Disulfide bondi76 ↔ 1291 Publication
Glycosylationi135 – 1351N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9UHD0.
PRIDEiQ9UHD0.

PTM databases

PhosphoSiteiQ9UHD0.

Expressioni

Gene expression databases

BgeeiQ9UHD0.
CleanExiHS_IL19.
GenevestigatoriQ9UHD0.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000343000.

Structurei

Secondary structure

1
177
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi23 – 264Combined sources
Turni28 – 314Combined sources
Helixi34 – 4916Combined sources
Helixi61 – 644Combined sources
Beta strandi65 – 673Combined sources
Helixi71 – 8717Combined sources
Helixi89 – 924Combined sources
Helixi98 – 12124Combined sources
Helixi131 – 14616Combined sources
Helixi149 – 15810Combined sources
Helixi160 – 17011Combined sources

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1N1FX-ray1.95A19-177[»]
ProteinModelPortaliQ9UHD0.
SMRiQ9UHD0. Positions 22-177.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UHD0.

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-10 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG26818.
GeneTreeiENSGT00410000025637.
HOGENOMiHOG000113033.
HOVERGENiHBG108002.
InParanoidiQ9UHD0.
KOiK05444.
OMAiLDVFLAW.
OrthoDBiEOG7060SK.
PhylomeDBiQ9UHD0.
TreeFamiTF333253.

Family and domain databases

Gene3Di1.20.1250.10. 1 hit.
InterProiIPR009079. 4_helix_cytokine-like_core.
IPR012351. 4_helix_cytokine_core.
IPR020443. IL-10/19/20/24/26_fam.
IPR020423. IL-10_CS.
IPR020421. IL-19.
[Graphical view]
PANTHERiPTHR11585. PTHR11585. 1 hit.
PfamiPF00726. IL10. 1 hit.
[Graphical view]
PRINTSiPR01934. INTRLEUKIN19.
SMARTiSM00188. IL10. 1 hit.
[Graphical view]
SUPFAMiSSF47266. SSF47266. 1 hit.
PROSITEiPS00520. INTERLEUKIN_10. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UHD0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLQCVSLWL LGTILILCSV DNHGLRRCLI STDMHHIEES FQEIKRAIQA
60 70 80 90 100
KDTFPNVTIL STLETLQIIK PLDVCCVTKN LLAFYVDRVF KDHQEPNPKI
110 120 130 140 150
LRKISSIANS FLYMQKTLRQ CQEQRQCHCR QEATNATRVI HDNYDQLEVH
160 170
AAAIKSLGEL DVFLAWINKN HEVMFSA
Length:177
Mass (Da):20,452
Last modified:May 1, 2007 - v2
Checksum:i7CCFB052177DE408
GO
Isoform 2 (identifier: Q9UHD0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM

Show »
Length:215
Mass (Da):24,568
Checksum:iD79D6B0F11DA74E4
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti175 – 1751F → S.4 Publications
Corresponds to variant rs2243191 [ dbSNP | Ensembl ].
VAR_013077

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MCTEGAFPHRSACSLPLTHV HTHIHVCVPVLWGSVPRGM in isoform 2. 1 PublicationVSP_046253

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF276915 Genomic DNA. Translation: AAG16755.1.
AY040367 mRNA. Translation: AAK91776.1.
AF453946 mRNA. Translation: AAN40906.1.
AF192498 mRNA. Translation: AAF06663.1.
AF390905 Genomic DNA. Translation: AAK64498.1.
AL513315 Genomic DNA. Translation: CAH71814.1.
AL049615 Genomic DNA. Translation: CAB72342.1.
CCDSiCCDS1468.1. [Q9UHD0-2]
CCDS1469.1. [Q9UHD0-1]
RefSeqiNP_037503.2. NM_013371.3. [Q9UHD0-1]
NP_715639.1. NM_153758.2. [Q9UHD0-2]
UniGeneiHs.661017.

Genome annotation databases

EnsembliENST00000270218; ENSP00000270218; ENSG00000142224. [Q9UHD0-1]
ENST00000340758; ENSP00000343000; ENSG00000142224. [Q9UHD0-2]
ENST00000620365; ENSP00000482668; ENSG00000142224. [Q9UHD0-1]
GeneIDi29949.
KEGGihsa:29949.
UCSCiuc001hep.3. human. [Q9UHD0-1]

Polymorphism databases

DMDMi146345440.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF276915 Genomic DNA. Translation: AAG16755.1 .
AY040367 mRNA. Translation: AAK91776.1 .
AF453946 mRNA. Translation: AAN40906.1 .
AF192498 mRNA. Translation: AAF06663.1 .
AF390905 Genomic DNA. Translation: AAK64498.1 .
AL513315 Genomic DNA. Translation: CAH71814.1 .
AL049615 Genomic DNA. Translation: CAB72342.1 .
CCDSi CCDS1468.1. [Q9UHD0-2 ]
CCDS1469.1. [Q9UHD0-1 ]
RefSeqi NP_037503.2. NM_013371.3. [Q9UHD0-1 ]
NP_715639.1. NM_153758.2. [Q9UHD0-2 ]
UniGenei Hs.661017.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1N1F X-ray 1.95 A 19-177 [» ]
ProteinModelPortali Q9UHD0.
SMRi Q9UHD0. Positions 22-177.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000343000.

PTM databases

PhosphoSitei Q9UHD0.

Polymorphism databases

DMDMi 146345440.

Proteomic databases

PaxDbi Q9UHD0.
PRIDEi Q9UHD0.

Protocols and materials databases

DNASUi 29949.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000270218 ; ENSP00000270218 ; ENSG00000142224 . [Q9UHD0-1 ]
ENST00000340758 ; ENSP00000343000 ; ENSG00000142224 . [Q9UHD0-2 ]
ENST00000620365 ; ENSP00000482668 ; ENSG00000142224 . [Q9UHD0-1 ]
GeneIDi 29949.
KEGGi hsa:29949.
UCSCi uc001hep.3. human. [Q9UHD0-1 ]

Organism-specific databases

CTDi 29949.
GeneCardsi GC01P206972.
HGNCi HGNC:5990. IL19.
MIMi 605687. gene.
neXtProti NX_Q9UHD0.
PharmGKBi PA29806.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG26818.
GeneTreei ENSGT00410000025637.
HOGENOMi HOG000113033.
HOVERGENi HBG108002.
InParanoidi Q9UHD0.
KOi K05444.
OMAi LDVFLAW.
OrthoDBi EOG7060SK.
PhylomeDBi Q9UHD0.
TreeFami TF333253.

Enzyme and pathway databases

SignaLinki Q9UHD0.

Miscellaneous databases

EvolutionaryTracei Q9UHD0.
GenomeRNAii 29949.
NextBioi 52635.
PROi Q9UHD0.
SOURCEi Search...

Gene expression databases

Bgeei Q9UHD0.
CleanExi HS_IL19.
Genevestigatori Q9UHD0.

Family and domain databases

Gene3Di 1.20.1250.10. 1 hit.
InterProi IPR009079. 4_helix_cytokine-like_core.
IPR012351. 4_helix_cytokine_core.
IPR020443. IL-10/19/20/24/26_fam.
IPR020423. IL-10_CS.
IPR020421. IL-19.
[Graphical view ]
PANTHERi PTHR11585. PTHR11585. 1 hit.
Pfami PF00726. IL10. 1 hit.
[Graphical view ]
PRINTSi PR01934. INTRLEUKIN19.
SMARTi SM00188. IL10. 1 hit.
[Graphical view ]
SUPFAMi SSF47266. SSF47266. 1 hit.
PROSITEi PS00520. INTERLEUKIN_10. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homolog of human interleukin-10 (IL-10)."
    Gallagher G., Dickensheets H., Eskdale J., Izotova L.S., Mirochnitchenko O.V., Peat J.D., Vasquez N., Pestka S., Donnelly R.P., Kotenko S.V.
    Genes Immun. 1:442-450(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT SER-175.
  2. "IL-19 induces production of IL-6 and TNF-alpha and results in cell apoptosis through TNF-alpha."
    Liao Y.-C., Liang W.G., Chen F.W., Hsu J.H., Yang J.J., Chang M.-S.
    J. Immunol. 169:4288-4297(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175.
  3. "Homo sapiens homolog of melanoma differentiation associated gene."
    Conklin D., Petersen J., Loften-Day C., Whitmore T., Muerer M., Sexson S., Smith D., Lok S., Pownder T., O'Hara P.
    Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175.
  4. SeattleSNPs variation discovery resource
    Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-175.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 25-39.
  7. "Crystal structure of interleukin-19 defines a new subfamily of helical cytokines."
    Chang C., Magracheva E., Kozlov S., Fong S., Tobin G., Kotenko S., Wlodawer A., Zdanov A.
    J. Biol. Chem. 278:3308-3313(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 19-177, DISULFIDE BONDS.

Entry informationi

Entry nameiIL19_HUMAN
AccessioniPrimary (citable) accession number: Q9UHD0
Secondary accession number(s): Q5VUT3, Q96QR4, Q9NUA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 16, 2001
Last sequence update: May 1, 2007
Last modified: October 29, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3