Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UHD0

- IL19_HUMAN

UniProt

Q9UHD0 - IL19_HUMAN

Protein

Interleukin-19

Gene

IL19

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis By similarity.By similarity

    GO - Molecular functioni

    1. cytokine activity Source: UniProtKB

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. immune response Source: UniProtKB
    3. interleukin-6 biosynthetic process Source: Ensembl
    4. negative regulation of extrinsic apoptotic signaling pathway Source: Ensembl
    5. positive regulation of intrinsic apoptotic signaling pathway Source: Ensembl
    6. reactive oxygen species metabolic process Source: Ensembl
    7. signal transduction Source: UniProtKB

    Keywords - Molecular functioni

    Cytokine

    Keywords - Biological processi

    Apoptosis

    Enzyme and pathway databases

    SignaLinkiQ9UHD0.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-19
    Short name:
    IL-19
    Alternative name(s):
    Melanoma differentiation-associated protein-like protein
    NG.1
    Gene namesi
    Name:IL19
    Synonyms:ZMDA1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:5990. IL19.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB
    2. extracellular space Source: UniProtKB-KW

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29806.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 24241 PublicationAdd
    BLAST
    Chaini25 – 177153Interleukin-19PRO_0000015379Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi28 ↔ 1211 Publication
    Glycosylationi56 – 561N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi75 ↔ 1271 Publication
    Disulfide bondi76 ↔ 1291 Publication
    Glycosylationi135 – 1351N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9UHD0.
    PRIDEiQ9UHD0.

    PTM databases

    PhosphoSiteiQ9UHD0.

    Expressioni

    Gene expression databases

    BgeeiQ9UHD0.
    CleanExiHS_IL19.
    GenevestigatoriQ9UHD0.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000343000.

    Structurei

    Secondary structure

    1
    177
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi23 – 264
    Turni28 – 314
    Helixi34 – 4916
    Helixi61 – 644
    Beta strandi65 – 673
    Helixi71 – 8717
    Helixi89 – 924
    Helixi98 – 12124
    Helixi131 – 14616
    Helixi149 – 15810
    Helixi160 – 17011

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1N1FX-ray1.95A19-177[»]
    ProteinModelPortaliQ9UHD0.
    SMRiQ9UHD0. Positions 22-177.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9UHD0.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the IL-10 family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG26818.
    HOGENOMiHOG000113033.
    HOVERGENiHBG108002.
    InParanoidiQ9UHD0.
    KOiK05444.
    OMAiLDVFLAW.
    OrthoDBiEOG7060SK.
    PhylomeDBiQ9UHD0.
    TreeFamiTF333253.

    Family and domain databases

    Gene3Di1.20.1250.10. 1 hit.
    InterProiIPR009079. 4_helix_cytokine-like_core.
    IPR012351. 4_helix_cytokine_core.
    IPR020443. IL-10/19/20/24/26_fam.
    IPR020423. IL-10_CS.
    IPR020421. IL-19.
    [Graphical view]
    PANTHERiPTHR11585. PTHR11585. 1 hit.
    PfamiPF00726. IL10. 1 hit.
    [Graphical view]
    PRINTSiPR01934. INTRLEUKIN19.
    SMARTiSM00188. IL10. 1 hit.
    [Graphical view]
    SUPFAMiSSF47266. SSF47266. 1 hit.
    PROSITEiPS00520. INTERLEUKIN_10. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UHD0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKLQCVSLWL LGTILILCSV DNHGLRRCLI STDMHHIEES FQEIKRAIQA    50
    KDTFPNVTIL STLETLQIIK PLDVCCVTKN LLAFYVDRVF KDHQEPNPKI 100
    LRKISSIANS FLYMQKTLRQ CQEQRQCHCR QEATNATRVI HDNYDQLEVH 150
    AAAIKSLGEL DVFLAWINKN HEVMFSA 177
    Length:177
    Mass (Da):20,452
    Last modified:May 1, 2007 - v2
    Checksum:i7CCFB052177DE408
    GO
    Isoform 2 (identifier: Q9UHD0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCTEGAFPHRSACSLPLTHVHTHIHVCVPVLWGSVPRGM

    Show »
    Length:215
    Mass (Da):24,568
    Checksum:iD79D6B0F11DA74E4
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti175 – 1751F → S.4 Publications
    Corresponds to variant rs2243191 [ dbSNP | Ensembl ].
    VAR_013077

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MCTEGAFPHRSACSLPLTHV HTHIHVCVPVLWGSVPRGM in isoform 2. 1 PublicationVSP_046253

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF276915 Genomic DNA. Translation: AAG16755.1.
    AY040367 mRNA. Translation: AAK91776.1.
    AF453946 mRNA. Translation: AAN40906.1.
    AF192498 mRNA. Translation: AAF06663.1.
    AF390905 Genomic DNA. Translation: AAK64498.1.
    AL513315 Genomic DNA. Translation: CAH71814.1.
    AL049615 Genomic DNA. Translation: CAB72342.1.
    CCDSiCCDS1468.1. [Q9UHD0-2]
    CCDS1469.1. [Q9UHD0-1]
    RefSeqiNP_037503.2. NM_013371.3. [Q9UHD0-1]
    NP_715639.1. NM_153758.2. [Q9UHD0-2]
    UniGeneiHs.661017.

    Genome annotation databases

    EnsembliENST00000270218; ENSP00000270218; ENSG00000142224. [Q9UHD0-1]
    ENST00000340758; ENSP00000343000; ENSG00000142224. [Q9UHD0-2]
    GeneIDi29949.
    KEGGihsa:29949.
    UCSCiuc001hep.3. human. [Q9UHD0-1]

    Polymorphism databases

    DMDMi146345440.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF276915 Genomic DNA. Translation: AAG16755.1 .
    AY040367 mRNA. Translation: AAK91776.1 .
    AF453946 mRNA. Translation: AAN40906.1 .
    AF192498 mRNA. Translation: AAF06663.1 .
    AF390905 Genomic DNA. Translation: AAK64498.1 .
    AL513315 Genomic DNA. Translation: CAH71814.1 .
    AL049615 Genomic DNA. Translation: CAB72342.1 .
    CCDSi CCDS1468.1. [Q9UHD0-2 ]
    CCDS1469.1. [Q9UHD0-1 ]
    RefSeqi NP_037503.2. NM_013371.3. [Q9UHD0-1 ]
    NP_715639.1. NM_153758.2. [Q9UHD0-2 ]
    UniGenei Hs.661017.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1N1F X-ray 1.95 A 19-177 [» ]
    ProteinModelPortali Q9UHD0.
    SMRi Q9UHD0. Positions 22-177.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000343000.

    PTM databases

    PhosphoSitei Q9UHD0.

    Polymorphism databases

    DMDMi 146345440.

    Proteomic databases

    PaxDbi Q9UHD0.
    PRIDEi Q9UHD0.

    Protocols and materials databases

    DNASUi 29949.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000270218 ; ENSP00000270218 ; ENSG00000142224 . [Q9UHD0-1 ]
    ENST00000340758 ; ENSP00000343000 ; ENSG00000142224 . [Q9UHD0-2 ]
    GeneIDi 29949.
    KEGGi hsa:29949.
    UCSCi uc001hep.3. human. [Q9UHD0-1 ]

    Organism-specific databases

    CTDi 29949.
    GeneCardsi GC01P206972.
    HGNCi HGNC:5990. IL19.
    MIMi 605687. gene.
    neXtProti NX_Q9UHD0.
    PharmGKBi PA29806.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG26818.
    HOGENOMi HOG000113033.
    HOVERGENi HBG108002.
    InParanoidi Q9UHD0.
    KOi K05444.
    OMAi LDVFLAW.
    OrthoDBi EOG7060SK.
    PhylomeDBi Q9UHD0.
    TreeFami TF333253.

    Enzyme and pathway databases

    SignaLinki Q9UHD0.

    Miscellaneous databases

    EvolutionaryTracei Q9UHD0.
    GenomeRNAii 29949.
    NextBioi 52635.
    PROi Q9UHD0.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9UHD0.
    CleanExi HS_IL19.
    Genevestigatori Q9UHD0.

    Family and domain databases

    Gene3Di 1.20.1250.10. 1 hit.
    InterProi IPR009079. 4_helix_cytokine-like_core.
    IPR012351. 4_helix_cytokine_core.
    IPR020443. IL-10/19/20/24/26_fam.
    IPR020423. IL-10_CS.
    IPR020421. IL-19.
    [Graphical view ]
    PANTHERi PTHR11585. PTHR11585. 1 hit.
    Pfami PF00726. IL10. 1 hit.
    [Graphical view ]
    PRINTSi PR01934. INTRLEUKIN19.
    SMARTi SM00188. IL10. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47266. SSF47266. 1 hit.
    PROSITEi PS00520. INTERLEUKIN_10. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homolog of human interleukin-10 (IL-10)."
      Gallagher G., Dickensheets H., Eskdale J., Izotova L.S., Mirochnitchenko O.V., Peat J.D., Vasquez N., Pestka S., Donnelly R.P., Kotenko S.V.
      Genes Immun. 1:442-450(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), VARIANT SER-175.
    2. "IL-19 induces production of IL-6 and TNF-alpha and results in cell apoptosis through TNF-alpha."
      Liao Y.-C., Liang W.G., Chen F.W., Hsu J.H., Yang J.J., Chang M.-S.
      J. Immunol. 169:4288-4297(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175.
    3. "Homo sapiens homolog of melanoma differentiation associated gene."
      Conklin D., Petersen J., Loften-Day C., Whitmore T., Muerer M., Sexson S., Smith D., Lok S., Pownder T., O'Hara P.
      Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT SER-175.
    4. SeattleSNPs variation discovery resource
      Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT SER-175.
    5. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 25-39.
    7. "Crystal structure of interleukin-19 defines a new subfamily of helical cytokines."
      Chang C., Magracheva E., Kozlov S., Fong S., Tobin G., Kotenko S., Wlodawer A., Zdanov A.
      J. Biol. Chem. 278:3308-3313(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 19-177, DISULFIDE BONDS.

    Entry informationi

    Entry nameiIL19_HUMAN
    AccessioniPrimary (citable) accession number: Q9UHD0
    Secondary accession number(s): Q5VUT3, Q96QR4, Q9NUA0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 16, 2001
    Last sequence update: May 1, 2007
    Last modified: October 1, 2014
    This is version 123 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3