Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SUN domain-containing protein 2

Gene

SUN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of SUN-protein-containing multivariate complexes also called LINC complexes which link the nucleoskeleton and cytoskeleton by providing versatile outer nuclear membrane attachment sites for cytoskeletal filaments. Specifically, SYNE2 and SUN2 assemble in arrays of transmembrane actin-associated nuclear (TAN) lines which are bound to F-actin cables and couple the nucleus to retrograde actin flow during actin-dependent nuclear movement. Required for interkinetic nuclear migration (INM) and essential for nucleokinesis and centrosome-nucleus coupling during radial neuronal migration in the cerebral cortex and during glial migration. Anchors chromosome movement in the prophase of meiosis and is involved in selective gene expression of coding and non-coding RNAs needed for gametogenesis. Required for telomere attachment to nuclear envelope and gametogenesis. May also function on endocytic vesicles as a receptor for RAB5-GDP and participate in the activation of RAB5.1 Publication

GO - Molecular functioni

  • lamin binding Source: UniProtKB
  • microtubule binding Source: UniProtKB

GO - Biological processi

  • centrosome localization Source: UniProtKB
  • cytoskeletal anchoring at nuclear membrane Source: UniProtKB
  • mitotic spindle organization Source: UniProtKB
  • nuclear envelope organization Source: MGI
  • nuclear matrix anchoring at nuclear membrane Source: UniProtKB
  • nuclear migration Source: UniProtKB
  • nuclear migration along microfilament Source: UniProtKB
  • positive regulation of cell migration Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100242-MONOMER.
ReactomeiR-HSA-1221632. Meiotic synapsis.

Names & Taxonomyi

Protein namesi
Recommended name:
SUN domain-containing protein 2
Alternative name(s):
Protein unc-84 homolog B
Rab5-interacting protein
Short name:
Rab5IP
Sad1/unc-84 protein-like 2
Gene namesi
Name:SUN2
Synonyms:FRIGG, KIAA0668, RAB5IP, UNC84B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:14210. SUN2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 212Nuclear1 PublicationAdd BLAST212
Transmembranei213 – 233HelicalAdd BLAST21
Topological domaini234 – 717Perinuclear space1 PublicationAdd BLAST484

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi25777.
OpenTargetsiENSG00000100242.
PharmGKBiPA165378369.

Polymorphism and mutation databases

BioMutaiSUN2.
DMDMi29337242.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002189131 – 717SUN domain-containing protein 2Add BLAST717

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei12Phosphoserine1 Publication1
Modified residuei38PhosphoserineCombined sources1
Modified residuei54PhosphoserineCombined sources1 Publication1
Modified residuei107PhosphothreonineBy similarity1
Modified residuei110PhosphoserineBy similarity1
Modified residuei113PhosphoserineBy similarity1
Modified residuei116Phosphoserine1 Publication1
Modified residuei136PhosphoserineBy similarity1
Glycosylationi636N-linked (GlcNAc...)1 Publication1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ9UH99.
PaxDbiQ9UH99.
PeptideAtlasiQ9UH99.
PRIDEiQ9UH99.

PTM databases

iPTMnetiQ9UH99.
PhosphoSitePlusiQ9UH99.
SwissPalmiQ9UH99.

Expressioni

Tissue specificityi

Widely expressed. Highly expressed in heart, lung and muscle. Weakly expressed in fetal heart. Slightly overexpressed in some heart tissues form patients with congenital heart defects.2 Publications

Gene expression databases

BgeeiENSG00000100242.
CleanExiHS_UNC84B.
ExpressionAtlasiQ9UH99. baseline and differential.
GenevisibleiQ9UH99. HS.

Organism-specific databases

HPAiHPA001209.

Interactioni

Subunit structurei

Core component of the LINC complex which is composed of inner nuclear membrane SUN domain-containing proteins coupled to outer nuclear membrane KASH domain-containing nesprins. SUN domain-containing proteins interact with A-type lamins of the nuclear lamina, while at the other end of the complex, nesprins interact with unique cytoskeletal components. Interacts with SYNE1, SYNE2 and SYNE3. Interacts with A-type lamin. Interaction with lamins B1 and C is hardly detectable (By similarity). Interacts with EMD and RAB5A. Interacts with TMEM43.By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself2EBI-1044964,EBI-1044964
COPB1P536183EBI-1044964,EBI-359063
EMDP504023EBI-1044964,EBI-489887
KPNA2P522923EBI-1044964,EBI-349938
LMNAP025454EBI-1044964,EBI-351935
NRMQ8IXM63EBI-1044964,EBI-10262547
SYNE1Q8NF913EBI-1044964,EBI-928867
SYNE1Q8NF91-12EBI-1044964,EBI-6170938
SYNE2Q8WXH07EBI-1044964,EBI-2372294
SYNE2Q8WXH0-12EBI-1044964,EBI-6170976

GO - Molecular functioni

  • lamin binding Source: UniProtKB
  • microtubule binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117312. 46 interactors.
IntActiQ9UH99. 43 interactors.
MINTiMINT-3080157.
STRINGi9606.ENSP00000385616.

Structurei

Secondary structure

1717
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi525 – 540Combined sources16
Turni541 – 544Combined sources4
Helixi552 – 554Combined sources3
Beta strandi557 – 563Combined sources7
Helixi571 – 574Combined sources4
Turni575 – 577Combined sources3
Beta strandi579 – 584Combined sources6
Helixi588 – 592Combined sources5
Beta strandi601 – 605Combined sources5
Beta strandi609 – 627Combined sources19
Helixi631 – 633Combined sources3
Helixi635 – 637Combined sources3
Beta strandi645 – 655Combined sources11
Beta strandi660 – 666Combined sources7
Beta strandi669 – 671Combined sources3
Beta strandi673 – 678Combined sources6
Beta strandi687 – 694Combined sources8
Beta strandi697 – 699Combined sources3
Beta strandi701 – 706Combined sources6
Beta strandi708 – 714Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3UNPX-ray2.39A520-717[»]
4DXRX-ray2.32A522-717[»]
4DXSX-ray2.71A522-717[»]
4DXTX-ray2.22A522-717[»]
4FI9X-ray3.05A523-717[»]
ProteinModelPortaliQ9UH99.
SMRiQ9UH99.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini555 – 716SUNPROSITE-ProRule annotationAdd BLAST162

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 139LMNA-bindingBy similarityAdd BLAST139

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili273 – 296Sequence analysisAdd BLAST24
Coiled coili348 – 440Sequence analysisAdd BLAST93
Coiled coili475 – 506Sequence analysisAdd BLAST32

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi2 – 164Ser-richAdd BLAST163
Compositional biasi100 – 105Poly-Arg6
Compositional biasi316 – 322Poly-Gly7
Compositional biasi468 – 471Poly-Gly4

Domaini

The SUN domain may play a role in the nuclear anchoring and/or migration.

Sequence similaritiesi

Contains 1 SUN domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2687. Eukaryota.
ENOG410YM6S. LUCA.
GeneTreeiENSGT00390000011587.
HOGENOMiHOG000253025.
HOVERGENiHBG056957.
InParanoidiQ9UH99.
KOiK19347.
OMAiEHQQDSE.
OrthoDBiEOG091G0AZ8.
PhylomeDBiQ9UH99.
TreeFamiTF323915.

Family and domain databases

InterProiIPR030272. SUN2.
IPR012919. SUN_dom.
[Graphical view]
PANTHERiPTHR12911:SF22. PTHR12911:SF22. 1 hit.
PfamiPF07738. Sad1_UNC. 1 hit.
[Graphical view]
PROSITEiPS51469. SUN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UH99-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRRSQRLTR YSQGDDDGSS SSGGSSVAGS QSTLFKDSPL RTLKRKSSNM
60 70 80 90 100
KRLSPAPQLG PSSDAHTSYY SESLVHESWF PPRSSLEELH GDANWGEDLR
110 120 130 140 150
VRRRRGTGGS ESSRASGLVG RKATEDFLGS SSGYSSEDDY VGYSDVDQQS
160 170 180 190 200
SSSRLRSAVS RAGSLLWMVA TSPGRLFRLL YWWAGTTWYR LTTAASLLDV
210 220 230 240 250
FVLTRRFSSL KTFLWFLLPL LLLTCLTYGA WYFYPYGLQT FHPALVSWWA
260 270 280 290 300
AKDSRRPDEG WEARDSSPHF QAEQRVMSRV HSLERRLEAL AAEFSSNWQK
310 320 330 340 350
EAMRLERLEL RQGAPGQGGG GGLSHEDTLA LLEGLVSRRE AALKEDFRRE
360 370 380 390 400
TAARIQEELS ALRAEHQQDS EDLFKKIVRA SQESEARIQQ LKSEWQSMTQ
410 420 430 440 450
ESFQESSVKE LRRLEDQLAG LQQELAALAL KQSSVAEEVG LLPQQIQAVR
460 470 480 490 500
DDVESQFPAW ISQFLARGGG GRVGLLQREE MQAQLRELES KILTHVAEMQ
510 520 530 540 550
GKSAREAAAS LSLTLQKEGV IGVTEEQVHH IVKQALQRYS EDRIGLADYA
560 570 580 590 600
LESGGASVIS TRCSETYETK TALLSLFGIP LWYHSQSPRV ILQPDVHPGN
610 620 630 640 650
CWAFQGPQGF AVVRLSARIR PTAVTLEHVP KALSPNSTIS SAPKDFAIFG
660 670 680 690 700
FDEDLQQEGT LLGKFTYDQD GEPIQTFHFQ APTMATYQVV ELRILTNWGH
710
PEYTCIYRFR VHGEPAH
Length:717
Mass (Da):80,311
Last modified:March 25, 2003 - v3
Checksum:iCCF43C118E935E84
GO
Isoform 2 (identifier: Q9UH99-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-141: V → VEDSEGRGSKVTETEPVSSFPA

Note: No experimental confirmation available.
Show »
Length:738
Mass (Da):82,502
Checksum:iBD17ECBB9F58069B
GO
Isoform 3 (identifier: Q9UH99-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     683-717: TMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH → SSFPLCPWRLLPILGVCIYVAYHGGLGSWER

Note: No experimental confirmation available.
Show »
Length:713
Mass (Da):79,612
Checksum:i1D110119E43E562C
GO

Sequence cautioni

The sequence BAA31643 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti644K → R in CAD97926 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05228233T → A.Corresponds to variant rs2072799dbSNPEnsembl.1
Natural variantiVAR_05228389L → R.1 PublicationCorresponds to variant rs35496634dbSNPEnsembl.1
Natural variantiVAR_052284348R → C.Corresponds to variant rs138708dbSNPEnsembl.1
Natural variantiVAR_024624671G → S.1 PublicationCorresponds to variant rs2072797dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045882141V → VEDSEGRGSKVTETEPVSSF PA in isoform 2. 1 Publication1
Alternative sequenceiVSP_053702683 – 717TMATY…GEPAH → SSFPLCPWRLLPILGVCIYV AYHGGLGSWER in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014568 mRNA. Translation: BAA31643.1. Different initiation.
AY682988 mRNA. Translation: AAT90500.1.
CR456474 mRNA. Translation: CAG30360.1.
BX537962 mRNA. Translation: CAD97926.1.
AL008583 Genomic DNA. No translation available.
AL021806 Genomic DNA. No translation available.
AL021707 Genomic DNA. Translation: CAI21604.1.
AL021707 Genomic DNA. Translation: CAQ07913.1.
BC030684 mRNA. Translation: AAH30684.2.
BC094797 mRNA. Translation: AAH94797.1.
BC111549 mRNA. Translation: AAI11550.1.
BC111717 mRNA. Translation: AAI11718.1.
AF202723 mRNA. Translation: AAF15887.1.
CCDSiCCDS13978.1. [Q9UH99-1]
CCDS56231.1. [Q9UH99-2]
PIRiT00371.
RefSeqiNP_001186508.1. NM_001199579.1. [Q9UH99-2]
NP_001186509.1. NM_001199580.1. [Q9UH99-1]
NP_056189.1. NM_015374.2. [Q9UH99-1]
UniGeneiHs.517622.
Hs.744734.

Genome annotation databases

EnsembliENST00000405018; ENSP00000385616; ENSG00000100242. [Q9UH99-2]
ENST00000405510; ENSP00000385740; ENSG00000100242. [Q9UH99-1]
ENST00000406622; ENSP00000383992; ENSG00000100242. [Q9UH99-1]
GeneIDi25777.
KEGGihsa:25777.
UCSCiuc003awh.3. human. [Q9UH99-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014568 mRNA. Translation: BAA31643.1. Different initiation.
AY682988 mRNA. Translation: AAT90500.1.
CR456474 mRNA. Translation: CAG30360.1.
BX537962 mRNA. Translation: CAD97926.1.
AL008583 Genomic DNA. No translation available.
AL021806 Genomic DNA. No translation available.
AL021707 Genomic DNA. Translation: CAI21604.1.
AL021707 Genomic DNA. Translation: CAQ07913.1.
BC030684 mRNA. Translation: AAH30684.2.
BC094797 mRNA. Translation: AAH94797.1.
BC111549 mRNA. Translation: AAI11550.1.
BC111717 mRNA. Translation: AAI11718.1.
AF202723 mRNA. Translation: AAF15887.1.
CCDSiCCDS13978.1. [Q9UH99-1]
CCDS56231.1. [Q9UH99-2]
PIRiT00371.
RefSeqiNP_001186508.1. NM_001199579.1. [Q9UH99-2]
NP_001186509.1. NM_001199580.1. [Q9UH99-1]
NP_056189.1. NM_015374.2. [Q9UH99-1]
UniGeneiHs.517622.
Hs.744734.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3UNPX-ray2.39A520-717[»]
4DXRX-ray2.32A522-717[»]
4DXSX-ray2.71A522-717[»]
4DXTX-ray2.22A522-717[»]
4FI9X-ray3.05A523-717[»]
ProteinModelPortaliQ9UH99.
SMRiQ9UH99.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117312. 46 interactors.
IntActiQ9UH99. 43 interactors.
MINTiMINT-3080157.
STRINGi9606.ENSP00000385616.

PTM databases

iPTMnetiQ9UH99.
PhosphoSitePlusiQ9UH99.
SwissPalmiQ9UH99.

Polymorphism and mutation databases

BioMutaiSUN2.
DMDMi29337242.

Proteomic databases

EPDiQ9UH99.
PaxDbiQ9UH99.
PeptideAtlasiQ9UH99.
PRIDEiQ9UH99.

Protocols and materials databases

DNASUi25777.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000405018; ENSP00000385616; ENSG00000100242. [Q9UH99-2]
ENST00000405510; ENSP00000385740; ENSG00000100242. [Q9UH99-1]
ENST00000406622; ENSP00000383992; ENSG00000100242. [Q9UH99-1]
GeneIDi25777.
KEGGihsa:25777.
UCSCiuc003awh.3. human. [Q9UH99-1]

Organism-specific databases

CTDi25777.
DisGeNETi25777.
GeneCardsiSUN2.
H-InvDBHIX0159176.
HGNCiHGNC:14210. SUN2.
HPAiHPA001209.
MIMi613569. gene.
neXtProtiNX_Q9UH99.
OpenTargetsiENSG00000100242.
PharmGKBiPA165378369.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2687. Eukaryota.
ENOG410YM6S. LUCA.
GeneTreeiENSGT00390000011587.
HOGENOMiHOG000253025.
HOVERGENiHBG056957.
InParanoidiQ9UH99.
KOiK19347.
OMAiEHQQDSE.
OrthoDBiEOG091G0AZ8.
PhylomeDBiQ9UH99.
TreeFamiTF323915.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100242-MONOMER.
ReactomeiR-HSA-1221632. Meiotic synapsis.

Miscellaneous databases

ChiTaRSiSUN2. human.
GeneWikiiUNC84B.
GenomeRNAii25777.
PROiQ9UH99.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100242.
CleanExiHS_UNC84B.
ExpressionAtlasiQ9UH99. baseline and differential.
GenevisibleiQ9UH99. HS.

Family and domain databases

InterProiIPR030272. SUN2.
IPR012919. SUN_dom.
[Graphical view]
PANTHERiPTHR12911:SF22. PTHR12911:SF22. 1 hit.
PfamiPF07738. Sad1_UNC. 1 hit.
[Graphical view]
PROSITEiPS51469. SUN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSUN2_HUMAN
AccessioniPrimary (citable) accession number: Q9UH99
Secondary accession number(s): B0QY62
, O75156, Q2NKN8, Q2T9F7, Q504T5, Q6B4H1, Q7Z3E3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: March 25, 2003
Last modified: November 2, 2016
This is version 153 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-50 is the initiator.Curated

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.