Q9UGQ2 (FLOWR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 92.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium channel flower homolog Alternative name(s): Calcium channel flower domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 172 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the calcium channel flower family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | calcium ion transmembrane transport Inferred from electronic annotation. Source: GOC synaptic vesicle endocytosisInferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to synaptic vesicle membrane Inferred from electronic annotation. Source: InterPro |
| Molecular_function | calcium channel activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UGQ2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UGQ2-2) The sequence of this isoform differs from the canonical sequence as follows: 65-107: IMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCG → M | ||||||
| Isoform 3 (identifier: Q9UGQ2-3) The sequence of this isoform differs from the canonical sequence as follows: 65-107: IMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCG → M 144-172: GDAISYARIQQQRQQADEEKLAETLEGEL → AQTEAGSFAA...SPLLALCGSK | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9UGQ2-4) The sequence of this isoform differs from the canonical sequence as follows: 144-172: GDAISYARIQQQRQQADEEKLAETLEGEL → AQTEAGSFAA...SPLLALCGSK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 172 | 172 | Calcium channel flower homolog | PRO_0000089671 | |||||
Regions | |||||||||
| Transmembrane | 33 – 53 | 21 | Helical; Potential | ||||||
| Transmembrane | 58 – 78 | 21 | Helical; Potential | ||||||
| Transmembrane | 103 – 123 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 65 – 107 | 43 | IMNAF…VFYCG → M in isoform 2 and isoform 3. | VSP_012997 | |||||
| Alternative sequence | 144 – 172 | 29 | GDAIS…LEGEL → AQTEAGSFAAQHPREPGPFS EGTRQAFATPAVVSGEIRMP AGAMRSPMPGSSSRGSRRMR RSSRRPWRGSCEGLGAPPSL SPLLALCGSK in isoform 3 and isoform 4. | VSP_042522 | |||||
| Natural variant | 58 | 1 | I → M. Ref.3 Corresponds to variant rs3124765 [ dbSNP | Ensembl ]. | VAR_069103 | |||||
Experimental info | |||||||||
| Sequence conflict | 110 | 1 | V → D in BAH12324. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of a sugar transporter gene, a G-beta subunit like gene and three novel genes in human chromosome 9q34." Young J.M., Woodward K.J., Aziz S., Burley M., Kwiatkowski D.J., Povey S. Submitted (SEP-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lymphoid tissue. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT MET-58. Tissue: Teratocarcinoma and Thalamus. |
| [4] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Teratocarcinoma. |
| [5] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ011373 mRNA. Translation: CAB66156.1. AK075548 mRNA. Translation: BAC11691.1. AY358452 mRNA. Translation: AAQ88817.1. AK074852 mRNA. Translation: BAC11245.1. AK075416 mRNA. Translation: BAC11606.1. AK296343 mRNA. Translation: BAH12324.1. AK298820 mRNA. Translation: BAH12877.1. AL593848 Genomic DNA. No translation available. BC030558 mRNA. Translation: AAH30558.1. |
| IPI | IPI00014279. IPI00168285. IPI00922209. IPI00922836. |
| RefSeq | NP_001129247.1. NM_001135775.2. NP_001229298.1. NM_001242369.1. NP_001229299.1. NM_001242370.1. NP_060056.1. NM_017586.3. |
| UniGene | Hs.62003. |
3D structure databases | |
| ProteinModelPortal | Q9UGQ2. |
| ModBase | Search... |
Protein family/group databases | |
| TCDB | 1.A.55.1.1. synaptic vesicle-associated Ca2+ channel, flower (Flower or Cg6151-p) family. |
PTM databases | |
| PhosphoSite | Q9UGQ2. |
Polymorphism databases | |
| DMDM | 61212251. |
Proteomic databases | |
| PaxDb | Q9UGQ2. |
| PRIDE | Q9UGQ2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000291722; ENSP00000291722; ENSG00000160325. ENST00000316948; ENSP00000317121; ENSG00000160325. ENST00000540581; ENSP00000440832; ENSG00000160325. ENST00000542192; ENSP00000444328; ENSG00000160325. ENST00000568974; ENSP00000456209; ENSG00000260502. ENST00000570003; ENSP00000456530; ENSG00000260502. |
| GeneID | 11094. |
| KEGG | hsa:11094. |
| UCSC | uc004cec.2. human. uc011mdg.1. human. |
Organism-specific databases | |
| CTD | 11094. |
| GeneCards | GC09P136326. |
| HGNC | HGNC:1365. CACFD1. |
| HPA | HPA015280. |
| MIM | 613104. gene. |
| neXtProt | NX_Q9UGQ2. |
| PharmGKB | PA25982. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG318304. |
| HOGENOM | HOG000231809. |
| HOVERGEN | HBG050956. |
| InParanoid | Q9UGQ2. |
| OrthoDB | EOG4255V0. |
| PhylomeDB | Q9UGQ2. |
Gene expression databases | |
| ArrayExpress | Q9UGQ2. |
| Bgee | Q9UGQ2. |
| CleanEx | HS_C9orf7. |
| Genevestigator | Q9UGQ2. |
| GermOnline | ENSG00000160325. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR024947. Ca-channel_flower. IPR019365. TVP18/Ca-channel_flower. [Graphical view] |
| PANTHER | PTHR13314. PTHR13314. 1 hit. |
| Pfam | PF10233. Cg6151-P. 1 hit. [Graphical view] |
| SMART | SM01077. Cg6151-P. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 11094. |
| NextBio | 42174. |
| SOURCE | Search... |
Entry information
| Entry name | FLOWR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UGQ2 Secondary accession number(s): B7Z3T8 Q8NBM6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
