Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UGK3

- STAP2_HUMAN

UniProt

Q9UGK3 - STAP2_HUMAN

Protein

Signal-transducing adaptor protein 2

Gene

STAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 109 (01 Oct 2014)
      Sequence version 2 (05 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.1 Publication

    GO - Molecular functioni

    1. protein binding Source: IntAct

    Enzyme and pathway databases

    SignaLinkiQ9UGK3.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Signal-transducing adaptor protein 2
    Short name:
    STAP-2
    Alternative name(s):
    Breast tumor kinase substrate
    Short name:
    BRK substrate
    Gene namesi
    Name:STAP2
    Synonyms:BKS
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:30430. STAP2.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. plasma membrane Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi22 – 221Y → F: Small decrease in tyrosine phosphorylation. 1 Publication
    Mutagenesisi250 – 2501Y → F: Loss of tyrosine phosphorylation. 1 Publication
    Mutagenesisi310 – 3101Y → F: Decrease in tyrosine phosphorylation. 1 Publication
    Mutagenesisi322 – 3221Y → F: Decrease in tyrosine phosphorylation. 1 Publication

    Organism-specific databases

    PharmGKBiPA162404971.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 403403Signal-transducing adaptor protein 2PRO_0000072239Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei22 – 221Phosphotyrosine; by SRC1 Publication
    Modified residuei250 – 2501Phosphotyrosine; by PTK62 Publications
    Modified residuei310 – 3101Phosphotyrosine1 Publication
    Modified residuei322 – 3221Phosphotyrosine; by SRC1 Publication

    Post-translational modificationi

    Phosphorylated on tyrosine. Tyr-250 may be important for interaction with kinases. Phosphorylated by PTK6 at Tyr-250 modulates PTK6-mediated STAT3 activation. Tyr-22 and Tyr-322 appears to be phosphorylated by SRC.2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9UGK3.
    PaxDbiQ9UGK3.
    PRIDEiQ9UGK3.

    PTM databases

    PhosphoSiteiQ9UGK3.

    Expressioni

    Tissue specificityi

    Widely expressed.2 Publications

    Gene expression databases

    ArrayExpressiQ9UGK3.
    BgeeiQ9UGK3.
    CleanExiHS_STAP2.
    GenevestigatoriQ9UGK3.

    Organism-specific databases

    HPAiHPA002375.
    HPA027761.

    Interactioni

    Subunit structurei

    Interacts with PTK6 and CSF1R.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    IKBKBO149207EBI-1553984,EBI-81266
    MYD88Q998363EBI-1553984,EBI-447677

    Protein-protein interaction databases

    BioGridi120759. 10 interactions.
    IntActiQ9UGK3. 5 interactions.
    MINTiMINT-1213508.
    STRINGi9606.ENSP00000317912.

    Structurei

    Secondary structure

    1
    403
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi148 – 1503
    Helixi159 – 16810
    Beta strandi174 – 1796
    Beta strandi182 – 19110
    Beta strandi202 – 2043
    Beta strandi215 – 2195
    Helixi226 – 23611
    Beta strandi237 – 2393

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EL8NMR-A137-247[»]
    ProteinModelPortaliQ9UGK3.
    SMRiQ9UGK3. Positions 21-247.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9UGK3.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini18 – 130113PHAdd
    BLAST
    Domaini133 – 248116SH2PROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili382 – 40221Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi271 – 35989Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 PH domain.Curated
    Contains 1 SH2 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, SH2 domain

    Phylogenomic databases

    eggNOGiNOG43046.
    HOGENOMiHOG000063725.
    HOVERGENiHBG108516.
    OMAiPGHLYMM.
    PhylomeDBiQ9UGK3.
    TreeFamiTF332087.

    Family and domain databases

    Gene3Di3.30.505.10. 1 hit.
    InterProiIPR001849. PH_domain.
    IPR000980. SH2.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00252. SH2. 1 hit.
    [Graphical view]
    SUPFAMiSSF55550. SSF55550. 1 hit.
    PROSITEiPS50001. SH2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UGK3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASALRPPRV PKPKGVLPSH YYESFLEKKG PCDRDYKKFW AGLQGLTIYF    50
    YNSNRDFQHV EKLNLGAFEK LTDEIPWGSS RDPGTHFSLI LRDQEIKFKV 100
    ETLECREMWK GFILTVVELR VPTDLTLLPG HLYMMSEVLA KEEARRALET 150
    PSCFLKVSRL EAQLLLERYP ECGNLLLRPS GDGADGVSVT TRQMHNGTHV 200
    VRHYKVKREG PKYVIDVEQP FSCTSLDAVV NYFVSHTKKA LVPFLLDEDY 250
    EKVLGYVEAD KENGENVWVA PSAPGPGPAP CTGGPKPLSP ASSQDKLPPL 300
    PPLPNQEENY VTPIGDGPAV DYENQDVASS SWPVILKPKK LPKPPAKLPK 350
    PPVGPKPEPK VFNGGLGRKL PVSSAQPLFP TAGLADMTAE LQKKLEKRRA 400
    LEH 403
    Length:403
    Mass (Da):44,894
    Last modified:May 5, 2009 - v2
    Checksum:iA5E809B3F233EFD0
    GO
    Isoform 2 (identifier: Q9UGK3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         356-356: K → KPVEKGFHHVAQAGLELLTSSDPPTSASQSAGITGVSHHTWPHLSSL

    Note: Alu insert from position 358 to 403.

    Show »
    Length:449
    Mass (Da):49,649
    Checksum:i31A9048F7B0E750F
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti93 – 931D → N.3 Publications
    Corresponds to variant rs7247504 [ dbSNP | Ensembl ].
    VAR_055239

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei356 – 3561K → KPVEKGFHHVAQAGLELLTS SDPPTSASQSAGITGVSHHT WPHLSSL in isoform 2. 1 PublicationVSP_041403

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ245719 mRNA. Translation: CAB65105.1.
    AK000241 mRNA. Translation: BAA91028.1.
    AC008616 Genomic DNA. No translation available.
    BC000795 mRNA. Translation: AAH00795.1.
    CCDSiCCDS12128.1. [Q9UGK3-2]
    CCDS45926.1. [Q9UGK3-1]
    RefSeqiNP_001013863.1. NM_001013841.1. [Q9UGK3-1]
    NP_060190.2. NM_017720.2. [Q9UGK3-2]
    UniGeneiHs.194385.

    Genome annotation databases

    EnsembliENST00000594605; ENSP00000471052; ENSG00000178078. [Q9UGK3-1]
    ENST00000600324; ENSP00000468927; ENSG00000178078. [Q9UGK3-2]
    GeneIDi55620.
    KEGGihsa:55620.
    UCSCiuc002mab.3. human. [Q9UGK3-1]
    uc002mac.3. human. [Q9UGK3-2]

    Polymorphism databases

    DMDMi229462752.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ245719 mRNA. Translation: CAB65105.1 .
    AK000241 mRNA. Translation: BAA91028.1 .
    AC008616 Genomic DNA. No translation available.
    BC000795 mRNA. Translation: AAH00795.1 .
    CCDSi CCDS12128.1. [Q9UGK3-2 ]
    CCDS45926.1. [Q9UGK3-1 ]
    RefSeqi NP_001013863.1. NM_001013841.1. [Q9UGK3-1 ]
    NP_060190.2. NM_017720.2. [Q9UGK3-2 ]
    UniGenei Hs.194385.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EL8 NMR - A 137-247 [» ]
    ProteinModelPortali Q9UGK3.
    SMRi Q9UGK3. Positions 21-247.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120759. 10 interactions.
    IntActi Q9UGK3. 5 interactions.
    MINTi MINT-1213508.
    STRINGi 9606.ENSP00000317912.

    PTM databases

    PhosphoSitei Q9UGK3.

    Polymorphism databases

    DMDMi 229462752.

    Proteomic databases

    MaxQBi Q9UGK3.
    PaxDbi Q9UGK3.
    PRIDEi Q9UGK3.

    Protocols and materials databases

    DNASUi 55620.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000594605 ; ENSP00000471052 ; ENSG00000178078 . [Q9UGK3-1 ]
    ENST00000600324 ; ENSP00000468927 ; ENSG00000178078 . [Q9UGK3-2 ]
    GeneIDi 55620.
    KEGGi hsa:55620.
    UCSCi uc002mab.3. human. [Q9UGK3-1 ]
    uc002mac.3. human. [Q9UGK3-2 ]

    Organism-specific databases

    CTDi 55620.
    GeneCardsi GC19M004324.
    H-InvDB HIX0018702.
    HGNCi HGNC:30430. STAP2.
    HPAi HPA002375.
    HPA027761.
    MIMi 607881. gene.
    neXtProti NX_Q9UGK3.
    PharmGKBi PA162404971.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG43046.
    HOGENOMi HOG000063725.
    HOVERGENi HBG108516.
    OMAi PGHLYMM.
    PhylomeDBi Q9UGK3.
    TreeFami TF332087.

    Enzyme and pathway databases

    SignaLinki Q9UGK3.

    Miscellaneous databases

    EvolutionaryTracei Q9UGK3.
    GeneWikii STAP2.
    GenomeRNAii 55620.
    NextBioi 60220.
    PROi Q9UGK3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UGK3.
    Bgeei Q9UGK3.
    CleanExi HS_STAP2.
    Genevestigatori Q9UGK3.

    Family and domain databases

    Gene3Di 3.30.505.10. 1 hit.
    InterProi IPR001849. PH_domain.
    IPR000980. SH2.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00252. SH2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55550. SSF55550. 1 hit.
    PROSITEi PS50001. SH2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel adaptor-like protein which is a substrate for the non-receptor tyrosine kinase, BRK."
      Mitchell P.J., Sara E.A., Crompton M.R.
      Oncogene 19:4273-4282(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PTK6, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT ASN-93.
      Tissue: Mammary gland.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASN-93.
      Tissue: Colon mucosa.
    3. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-93.
      Tissue: Placenta.
    5. "STAP-2/BKS, an adaptor/docking protein, modulates STAT3 activation in acute-phase response through its YXXQ motif."
      Minoguchi M., Minoguchi S., Aki D., Joo A., Yamamoto T., Yumioka T., Matsuda T., Yoshimura A.
      J. Biol. Chem. 278:11182-11189(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, PHOSPHORYLATION AT TYR-22; TYR-250; TYR-310 AND TYR-322, MUTAGENESIS OF TYR-22; TYR-250; TYR-310 AND TYR-322.
    6. "STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation."
      Ikeda O., Miyasaka Y., Sekine Y., Mizushima A., Muromoto R., Nanbo A., Yoshimura A., Matsuda T.
      Biochem. Biophys. Res. Commun. 384:71-75(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-250 BY PTK6, INTERACTION WITH PTK6.
    7. "Solution structure of the human STAP2 SH2 domain."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 137-247.

    Entry informationi

    Entry nameiSTAP2_HUMAN
    AccessioniPrimary (citable) accession number: Q9UGK3
    Secondary accession number(s): A6NKK3, Q9NXI2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 12, 2005
    Last sequence update: May 5, 2009
    Last modified: October 1, 2014
    This is version 109 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3