Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Signal-transducing adaptor protein 2

Gene

STAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.1 Publication

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000178078-MONOMER.
ReactomeiR-HSA-8849474. PTK6 Activates STAT3.
SignaLinkiQ9UGK3.
SIGNORiQ9UGK3.

Names & Taxonomyi

Protein namesi
Recommended name:
Signal-transducing adaptor protein 2
Short name:
STAP-2
Alternative name(s):
Breast tumor kinase substrate
Short name:
BRK substrate
Gene namesi
Name:STAP2
Synonyms:BKS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30430. STAP2.

Subcellular locationi

  • Cytoplasm 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi22Y → F: Small decrease in tyrosine phosphorylation. 1 Publication1
Mutagenesisi250Y → F: Loss of tyrosine phosphorylation. 1 Publication1
Mutagenesisi310Y → F: Decrease in tyrosine phosphorylation. 1 Publication1
Mutagenesisi322Y → F: Decrease in tyrosine phosphorylation. 1 Publication1

Organism-specific databases

DisGeNETi55620.
OpenTargetsiENSG00000178078.
PharmGKBiPA162404971.

Polymorphism and mutation databases

BioMutaiSTAP2.
DMDMi229462752.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000722391 – 403Signal-transducing adaptor protein 2Add BLAST403

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei22Phosphotyrosine; by SRC1 Publication1
Modified residuei250Phosphotyrosine; by PTK62 Publications1
Modified residuei310Phosphotyrosine1 Publication1
Modified residuei322Phosphotyrosine; by SRC1 Publication1

Post-translational modificationi

Phosphorylated on tyrosine. Tyr-250 may be important for interaction with kinases. Phosphorylated by PTK6 at Tyr-250 modulates PTK6-mediated STAT3 activation. Tyr-22 and Tyr-322 appears to be phosphorylated by SRC.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UGK3.
PeptideAtlasiQ9UGK3.
PRIDEiQ9UGK3.

PTM databases

iPTMnetiQ9UGK3.
PhosphoSitePlusiQ9UGK3.

Expressioni

Tissue specificityi

Widely expressed.2 Publications

Gene expression databases

BgeeiENSG00000178078.
CleanExiHS_STAP2.
ExpressionAtlasiQ9UGK3. baseline and differential.
GenevisibleiQ9UGK3. HS.

Organism-specific databases

HPAiHPA002375.
HPA027761.

Interactioni

Subunit structurei

Interacts with PTK6 and CSF1R.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
IKBKBO149207EBI-1553984,EBI-81266
MYD88Q998363EBI-1553984,EBI-447677

Protein-protein interaction databases

BioGridi120759. 11 interactors.
IntActiQ9UGK3. 7 interactors.
MINTiMINT-1213508.

Structurei

Secondary structure

1403
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi148 – 150Combined sources3
Helixi159 – 168Combined sources10
Beta strandi174 – 179Combined sources6
Beta strandi182 – 191Combined sources10
Beta strandi202 – 204Combined sources3
Beta strandi215 – 219Combined sources5
Helixi226 – 236Combined sources11
Beta strandi237 – 239Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EL8NMR-A137-247[»]
ProteinModelPortaliQ9UGK3.
SMRiQ9UGK3.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UGK3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini18 – 130PHAdd BLAST113
Domaini133 – 248SH2PROSITE-ProRule annotationAdd BLAST116

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili382 – 402Sequence analysisAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi271 – 359Pro-richAdd BLAST89

Sequence similaritiesi

Contains 1 PH domain.Curated
Contains 1 SH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH2 domain

Phylogenomic databases

GeneTreeiENSGT00530000063841.
HOGENOMiHOG000063725.
HOVERGENiHBG108516.
InParanoidiQ9UGK3.
OMAiLYMMAEA.
OrthoDBiEOG091G0929.
PhylomeDBiQ9UGK3.
TreeFamiTF332087.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR000980. SH2.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UGK3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASALRPPRV PKPKGVLPSH YYESFLEKKG PCDRDYKKFW AGLQGLTIYF
60 70 80 90 100
YNSNRDFQHV EKLNLGAFEK LTDEIPWGSS RDPGTHFSLI LRDQEIKFKV
110 120 130 140 150
ETLECREMWK GFILTVVELR VPTDLTLLPG HLYMMSEVLA KEEARRALET
160 170 180 190 200
PSCFLKVSRL EAQLLLERYP ECGNLLLRPS GDGADGVSVT TRQMHNGTHV
210 220 230 240 250
VRHYKVKREG PKYVIDVEQP FSCTSLDAVV NYFVSHTKKA LVPFLLDEDY
260 270 280 290 300
EKVLGYVEAD KENGENVWVA PSAPGPGPAP CTGGPKPLSP ASSQDKLPPL
310 320 330 340 350
PPLPNQEENY VTPIGDGPAV DYENQDVASS SWPVILKPKK LPKPPAKLPK
360 370 380 390 400
PPVGPKPEPK VFNGGLGRKL PVSSAQPLFP TAGLADMTAE LQKKLEKRRA

LEH
Length:403
Mass (Da):44,894
Last modified:May 5, 2009 - v2
Checksum:iA5E809B3F233EFD0
GO
Isoform 2 (identifier: Q9UGK3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     356-356: K → KPVEKGFHHVAQAGLELLTSSDPPTSASQSAGITGVSHHTWPHLSSL

Note: Alu insert from position 358 to 403.
Show »
Length:449
Mass (Da):49,649
Checksum:i31A9048F7B0E750F
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05523993D → N.3 PublicationsCorresponds to variant rs7247504dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041403356K → KPVEKGFHHVAQAGLELLTS SDPPTSASQSAGITGVSHHT WPHLSSL in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245719 mRNA. Translation: CAB65105.1.
AK000241 mRNA. Translation: BAA91028.1.
AC008616 Genomic DNA. No translation available.
BC000795 mRNA. Translation: AAH00795.1.
CCDSiCCDS12128.1. [Q9UGK3-2]
CCDS45926.1. [Q9UGK3-1]
RefSeqiNP_001013863.1. NM_001013841.1. [Q9UGK3-1]
NP_060190.2. NM_017720.2. [Q9UGK3-2]
UniGeneiHs.194385.

Genome annotation databases

EnsembliENST00000594605; ENSP00000471052; ENSG00000178078. [Q9UGK3-1]
ENST00000600324; ENSP00000468927; ENSG00000178078. [Q9UGK3-2]
GeneIDi55620.
KEGGihsa:55620.
UCSCiuc060rvu.1. human. [Q9UGK3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ245719 mRNA. Translation: CAB65105.1.
AK000241 mRNA. Translation: BAA91028.1.
AC008616 Genomic DNA. No translation available.
BC000795 mRNA. Translation: AAH00795.1.
CCDSiCCDS12128.1. [Q9UGK3-2]
CCDS45926.1. [Q9UGK3-1]
RefSeqiNP_001013863.1. NM_001013841.1. [Q9UGK3-1]
NP_060190.2. NM_017720.2. [Q9UGK3-2]
UniGeneiHs.194385.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EL8NMR-A137-247[»]
ProteinModelPortaliQ9UGK3.
SMRiQ9UGK3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120759. 11 interactors.
IntActiQ9UGK3. 7 interactors.
MINTiMINT-1213508.

PTM databases

iPTMnetiQ9UGK3.
PhosphoSitePlusiQ9UGK3.

Polymorphism and mutation databases

BioMutaiSTAP2.
DMDMi229462752.

Proteomic databases

EPDiQ9UGK3.
PeptideAtlasiQ9UGK3.
PRIDEiQ9UGK3.

Protocols and materials databases

DNASUi55620.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000594605; ENSP00000471052; ENSG00000178078. [Q9UGK3-1]
ENST00000600324; ENSP00000468927; ENSG00000178078. [Q9UGK3-2]
GeneIDi55620.
KEGGihsa:55620.
UCSCiuc060rvu.1. human. [Q9UGK3-1]

Organism-specific databases

CTDi55620.
DisGeNETi55620.
GeneCardsiSTAP2.
H-InvDBHIX0018702.
HGNCiHGNC:30430. STAP2.
HPAiHPA002375.
HPA027761.
MIMi607881. gene.
neXtProtiNX_Q9UGK3.
OpenTargetsiENSG00000178078.
PharmGKBiPA162404971.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063841.
HOGENOMiHOG000063725.
HOVERGENiHBG108516.
InParanoidiQ9UGK3.
OMAiLYMMAEA.
OrthoDBiEOG091G0929.
PhylomeDBiQ9UGK3.
TreeFamiTF332087.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000178078-MONOMER.
ReactomeiR-HSA-8849474. PTK6 Activates STAT3.
SignaLinkiQ9UGK3.
SIGNORiQ9UGK3.

Miscellaneous databases

ChiTaRSiSTAP2. human.
EvolutionaryTraceiQ9UGK3.
GeneWikiiSTAP2.
GenomeRNAii55620.
PROiQ9UGK3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000178078.
CleanExiHS_STAP2.
ExpressionAtlasiQ9UGK3. baseline and differential.
GenevisibleiQ9UGK3. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR000980. SH2.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50001. SH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTAP2_HUMAN
AccessioniPrimary (citable) accession number: Q9UGK3
Secondary accession number(s): A6NKK3, Q9NXI2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: May 5, 2009
Last modified: November 30, 2016
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.