Q9UGK3 (STAP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Signal-transducing adaptor protein 2 Short name=STAP-2 Alternative name(s): Breast tumor kinase substrate Short name=BRK substrate | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 403 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity. Ref.1 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | |
| Post-translational modification | Phosphorylated on tyrosine. Tyr-250 may be important for interaction with kinases. Phosphorylated by PTK6 at Tyr-250 modulates PTK6-mediated STAT3 activation. Tyr-22 and Tyr-322 appears to be phosphorylated by SRC. Ref.5 Ref.6 |
| Sequence similarities | Contains 1 PH domain. Contains 1 SH2 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil SH2 domain |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from direct assay. Source: HPA plasma membraneInferred from electronic annotation. Source: Compara |
| Molecular_function | phospholipid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| IKBKB | O14920 | 7 | EBI-1553984,EBI-81266 | |
| MYD88 | Q99836 | 3 | EBI-1553984,EBI-447677 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UGK3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UGK3-2) The sequence of this isoform differs from the canonical sequence as follows: 356-356: K → KPVEKGFHHVAQAGLELLTSSDPPTSASQSAGITGVSHHTWPHLSSL | ||||||
| Note: Alu insert from position 358 to 403. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 403 | 403 | Signal-transducing adaptor protein 2 | PRO_0000072239 | ||||||||||||||||||||
Regions | ||||||||||||||||||||||||
| Domain | 18 – 130 | 113 | PH | |||||||||||||||||||||
| Domain | 133 – 248 | 116 | SH2 | |||||||||||||||||||||
| Coiled coil | 382 – 402 | 21 | Potential | |||||||||||||||||||||
| Compositional bias | 271 – 359 | 89 | Pro-rich | |||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||
| Modified residue | 22 | 1 | Phosphotyrosine; by SRC Probable | |||||||||||||||||||||
| Modified residue | 250 | 1 | Phosphotyrosine; by PTK6 Ref.5 Ref.6 | |||||||||||||||||||||
| Modified residue | 310 | 1 | Phosphotyrosine Probable | |||||||||||||||||||||
| Modified residue | 322 | 1 | Phosphotyrosine; by SRC Probable | |||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||
| Alternative sequence | 356 | 1 | K → KPVEKGFHHVAQAGLELLTS SDPPTSASQSAGITGVSHHT WPHLSSL in isoform 2. | VSP_041403 | ||||||||||||||||||||
| Natural variant | 93 | 1 | D → N. Ref.1 Ref.2 Ref.4 Corresponds to variant rs7247504 [ dbSNP | Ensembl ]. | VAR_055239 | ||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||
| Mutagenesis | 22 | 1 | Y → F: Small decrease in tyrosine phosphorylation. Ref.5 | |||||||||||||||||||||
| Mutagenesis | 250 | 1 | Y → F: Loss of tyrosine phosphorylation. Ref.5 | |||||||||||||||||||||
| Mutagenesis | 310 | 1 | Y → F: Decrease in tyrosine phosphorylation. Ref.5 | |||||||||||||||||||||
| Mutagenesis | 322 | 1 | Y → F: Decrease in tyrosine phosphorylation. Ref.5 | |||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||
| Beta strand | 148 – 150 | 3 | ||||||||||||||||||||||
| Helix | 159 – 168 | 10 | ||||||||||||||||||||||
| Beta strand | 174 – 179 | 6 | ||||||||||||||||||||||
| Beta strand | 182 – 191 | 10 | ||||||||||||||||||||||
| Beta strand | 202 – 204 | 3 | ||||||||||||||||||||||
| Beta strand | 215 – 219 | 5 | ||||||||||||||||||||||
| Helix | 226 – 236 | 11 | ||||||||||||||||||||||
| Beta strand | 237 – 239 | 3 | ||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel adaptor-like protein which is a substrate for the non-receptor tyrosine kinase, BRK." Mitchell P.J., Sara E.A., Crompton M.R. Oncogene 19:4273-4282(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PTK6, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT ASN-93. Tissue: Mammary gland. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASN-93. Tissue: Colon mucosa. |
| [3] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-93. Tissue: Placenta. |
| [5] | "STAP-2/BKS, an adaptor/docking protein, modulates STAT3 activation in acute-phase response through its YXXQ motif." Minoguchi M., Minoguchi S., Aki D., Joo A., Yamamoto T., Yumioka T., Matsuda T., Yoshimura A. J. Biol. Chem. 278:11182-11189(2003) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, PHOSPHORYLATION AT TYR-22; TYR-250; TYR-310 AND TYR-322, MUTAGENESIS OF TYR-22; TYR-250; TYR-310 AND TYR-322. |
| [6] | "STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation." Ikeda O., Miyasaka Y., Sekine Y., Mizushima A., Muromoto R., Nanbo A., Yoshimura A., Matsuda T. Biochem. Biophys. Res. Commun. 384:71-75(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-250 BY PTK6, INTERACTION WITH PTK6. |
| [7] | "Solution structure of the human STAP2 SH2 domain." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 137-247. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ245719 mRNA. Translation: CAB65105.1. AK000241 mRNA. Translation: BAA91028.1. AC008616 Genomic DNA. No translation available. BC000795 mRNA. Translation: AAH00795.1. | ||||||||||||
| IPI | IPI00015096. IPI00383883. | ||||||||||||
| RefSeq | NP_001013863.1. NM_001013841.1. NP_060190.2. NM_017720.2. | ||||||||||||
| UniGene | Hs.194385. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UGK3. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9UGK3. 4 interactions. | ||||||||||||
| MINT | MINT-1213508. | ||||||||||||
| STRING | 9606.ENSP00000317912. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UGK3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 229462752. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9UGK3. | ||||||||||||
| PRIDE | Q9UGK3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 55620. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000314714; ENSP00000317912; ENSG00000178078. ENST00000424810; ENSP00000411838; ENSG00000178078. ENST00000594605; ENSP00000471052; ENSG00000178078. ENST00000600324; ENSP00000468927; ENSG00000178078. | ||||||||||||
| GeneID | 55620. | ||||||||||||
| KEGG | hsa:55620. | ||||||||||||
| UCSC | uc002mab.3. human. uc002mac.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 55620. | ||||||||||||
| GeneCards | GC19M004324. | ||||||||||||
| H-InvDB | HIX0018702. | ||||||||||||
| HGNC | HGNC:30430. STAP2. | ||||||||||||
| HPA | HPA002375. HPA027761. | ||||||||||||
| MIM | 607881. gene. | ||||||||||||
| neXtProt | NX_Q9UGK3. | ||||||||||||
| PharmGKB | PA162404971. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG43046. | ||||||||||||
| HOGENOM | HOG000063725. | ||||||||||||
| HOVERGEN | HBG108516. | ||||||||||||
| OMA | LYMMAEA. | ||||||||||||
| OrthoDB | EOG4X3H1R. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q9UGK3. | ||||||||||||
| CleanEx | HS_STAP2. | ||||||||||||
| Genevestigator | Q9UGK3. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.505.10. 1 hit. | ||||||||||||
| InterPro | IPR001849. Pleckstrin_homology. IPR000980. SH2. [Graphical view] | ||||||||||||
| SMART | SM00233. PH. 1 hit. SM00252. SH2. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50003. PH_DOMAIN. False negative. PS50001. SH2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9UGK3. | ||||||||||||
| GenomeRNAi | 55620. | ||||||||||||
| NextBio | 60220. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | STAP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UGK3 Secondary accession number(s): A6NKK3, Q9NXI2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
