Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tight junction protein ZO-2

Gene

TJP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in tight junctions and adherens junctions.

GO - Molecular functioni

  • cadherin binding Source: BHF-UCL
  • guanylate kinase activity Source: ProtInc
  • protein binding, bridging Source: UniProtKB
  • protein C-terminus binding Source: Ensembl
  • protein domain specific binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-2028269. Signaling by Hippo.
R-HSA-351906. Apoptotic cleavage of cell adhesion proteins.
SIGNORiQ9UDY2.

Names & Taxonomyi

Protein namesi
Recommended name:
Tight junction protein ZO-2
Alternative name(s):
Tight junction protein 2
Zona occludens protein 2
Zonula occludens protein 2
Gene namesi
Name:TJP2
Synonyms:X104, ZO2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000119139.16.
HGNCiHGNC:11828. TJP2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Nucleus, Tight junction

Pathology & Biotechi

Involvement in diseasei

Familial hypercholanemia (FHCA)1 Publication
The disease may be caused by mutations affecting distinct genetic loci, including the gene represented in this entry.
Disease descriptionA disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
See also OMIM:607748
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01600448V → A in FHCA. 1 PublicationCorresponds to variant dbSNP:rs121918299Ensembl.1
Cholestasis, progressive familial intrahepatic, 4 (PFIC4)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by early onset of cholestasis that progresses to hepatic fibrosis, cirrhosis, and end-stage liver disease before adulthood.
See also OMIM:615878

Keywords - Diseasei

Disease mutation, Intrahepatic cholestasis

Organism-specific databases

DisGeNETi9414.
MalaCardsiTJP2.
MIMi607748. phenotype.
615878. phenotype.
OpenTargetsiENSG00000119139.
Orphaneti90635. Autosomal dominant non-syndromic sensorineural deafness type DFNA.
238475. Familial hypercholanemia.
79304. Progressive familial intrahepatic cholestasis type 2.
PharmGKBiPA36533.

Polymorphism and mutation databases

BioMutaiTJP2.
DMDMi317373313.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945431 – 1190Tight junction protein ZO-2Add BLAST1190

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei16PhosphoserineND:1
Modified residuei130PhosphoserineND:1
Modified residuei150PhosphoserineND:1
Modified residuei153PhosphoserineND:1
Modified residuei163PhosphoserineHMP:1
Modified residuei168PhosphoserineND:1
Modified residuei170PhosphoserineND:1
Modified residuei174PhosphoserineND:1
Modified residuei200PhosphoserineND:1
Modified residuei220PhosphoserineND:1
Modified residuei232PhosphoserineND:1
Modified residuei244PhosphoserineND:1
Modified residuei266PhosphoserineND:1
Modified residuei325PhosphoserineND:1
Modified residuei398PhosphoserineHMP:1
Modified residuei400PhosphoserineND:1
Modified residuei406PhosphoserineND:1
Modified residuei415PhosphoserineND:1
Modified residuei424PhosphoserineND:1
Modified residuei430PhosphoserineND:1
Modified residuei431PhosphoserineND:1
Modified residuei455PhosphothreonineND:1
Modified residuei499PhosphoserineND:1
Modified residuei574PhosphotyrosineHMP:1
Modified residuei702PhosphoserineND:1
Modified residuei902PhosphoserineHMP:1
Modified residuei905PhosphothreonineHMP:1
Modified residuei913PhosphoserineND:1
Modified residuei920PhosphoserineND:1
Modified residuei925PhosphothreonineND:1
Modified residuei933PhosphothreonineND:1
Modified residuei966PhosphoserineND:1
Modified residuei978PhosphoserineND:1
Modified residuei986PhosphoserineND:1
Modified residuei1006PhosphoserineHMP:1
Modified residuei1067PhosphoserineND:1
Modified residuei1068PhosphoserineND:1
Modified residuei1118PhosphotyrosineND:1
Modified residuei1131PhosphothreonineND:1
Modified residuei1147PhosphoserineND:1
Modified residuei1159PhosphoserineND:1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9UDY2.
PaxDbiQ9UDY2.
PeptideAtlasiQ9UDY2.
PRIDEiQ9UDY2.

PTM databases

iPTMnetiQ9UDY2.
PhosphoSitePlusiQ9UDY2.

Expressioni

Tissue specificityi

This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues.1 Publication

Gene expression databases

BgeeiENSG00000119139.
CleanExiHS_TJP2.
ExpressionAtlasiQ9UDY2. baseline and differential.
GenevisibleiQ9UDY2. HS.

Organism-specific databases

HPAiCAB009228.
HPA001813.

Interactioni

Subunit structurei

Homodimer, and heterodimer with ZO1. Interacts with occludin, SAFB and UBN1. Interaction with SAFB occurs in the nucleus. Interacts with SCRIB. Interacts with USP53 (via the C-terminal region) (By similarity).HMP:3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
LASP1Q148479EBI-1042602,EBI-742828

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114809. 73 interactors.
ELMiQ9UDY2.
IntActiQ9UDY2. 38 interactors.
MINTiMINT-1207536.
STRINGi9606.ENSP00000438262.

Structurei

Secondary structure

11190
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi306 – 311ND:6
Beta strandi315 – 317ND:3
Beta strandi321 – 332ND:12
Helixi337 – 341ND:5
Beta strandi349 – 353ND:5
Helixi363 – 372ND:10
Turni373 – 375ND:3
Beta strandi376 – 381ND:6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2OSGNMR-A/B306-385[»]
3E17X-ray1.75A/B306-384[»]
ProteinModelPortaliQ9UDY2.
SMRiQ9UDY2.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UDY2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini33 – 120PDZ 1IEP:Add BLAST88
Domaini307 – 385PDZ 2IEP:Add BLAST79
Domaini509 – 590PDZ 3IEP:Add BLAST82
Domaini604 – 669SH3IEP:Add BLAST66
Domaini678 – 876Guanylate kinase-likeIEP:Add BLAST199

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1188 – 1190Interaction with SCRIB1 Publication3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1162 – 1165Poly-Glu4

Sequence similaritiesi

Belongs to the MAGUK family.IKR:

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG3580. Eukaryota.
ENOG410XQP3. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000230923.
HOVERGENiHBG017627.
InParanoidiQ9UDY2.
KOiK06098.
OrthoDBiEOG091G0AJZ.
PhylomeDBiQ9UDY2.
TreeFamiTF315957.

Family and domain databases

CDDicd12027. SH3_ZO-2. 1 hit.
InterProiView protein in InterPro
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR036034. PDZ_sf.
IPR036028. SH3-like_dom_sf.
IPR001452. SH3_domain.
IPR005417. ZO.
IPR005419. ZO-2.
IPR035598. ZO-2_SH3.
PfamiView protein in Pfam
PF00625. Guanylate_kin. 1 hit.
PF00595. PDZ. 3 hits.
PF07653. SH3_2. 1 hit.
PRINTSiPR01597. ZONOCCLUDNS.
PR01599. ZONOCCLUDNS2.
SMARTiView protein in SMART
SM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiView protein in PROSITE
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform A1 (identifier: Q9UDY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVRGDRGFP PRRELSGWLR APGMEELIWE QYTVTLQKDS KRGFGIAVSG
60 70 80 90 100
GRDNPHFENG ETSIVISDVL PGGPADGLLQ ENDRVVMVNG TPMEDVLHSF
110 120 130 140 150
AVQQLRKSGK VAAIVVKRPR KVQVAALQAS PPLDQDDRAF EVMDEFDGRS
160 170 180 190 200
FRSGYSERSR LNSHGGRSRS WEDSPERGRP HERARSRERD LSRDRSRGRS
210 220 230 240 250
LERGLDQDHA RTRDRSRGRS LERGLDHDFG PSRDRDRDRS RGRSIDQDYE
260 270 280 290 300
RAYHRAYDPD YERAYSPEYR RGARHDARSR GPRSRSREHP HSRSPSPEPR
310 320 330 340 350
GRPGPIGVLL MKSRANEEYG LRLGSQIFVK EMTRTGLATK DGNLHEGDII
360 370 380 390 400
LKINGTVTEN MSLTDARKLI EKSRGKLQLV VLRDSQQTLI NIPSLNDSDS
410 420 430 440 450
EIEDISEIES NRSFSPEERR HQYSDYDYHS SSEKLKERPS SREDTPSRLS
460 470 480 490 500
RMGATPTPFK STGDIAGTVV PETNKEPRYQ EDPPAPQPKA APRTFLRPSP
510 520 530 540 550
EDEAIYGPNT KMVRFKKGDS VGLRLAGGND VGIFVAGIQE GTSAEQEGLQ
560 570 580 590 600
EGDQILKVNT QDFRGLVRED AVLYLLEIPK GEMVTILAQS RADVYRDILA
610 620 630 640 650
CGRGDSFFIR SHFECEKETP QSLAFTRGEV FRVVDTLYDG KLGNWLAVRI
660 670 680 690 700
GNELEKGLIP NKSRAEQMAS VQNAQRDNAG DRADFWRMRG QRSGVKKNLR
710 720 730 740 750
KSREDLTAVV SVSTKFPAYE RVLLREAGFK RPVVLFGPIA DIAMEKLANE
760 770 780 790 800
LPDWFQTAKT EPKDAGSEKS TGVVRLNTVR QIIEQDKHAL LDVTPKAVDL
810 820 830 840 850
LNYTQWFPIV IFFNPDSRQG VKTMRQRLNP TSNKSSRKLF DQANKLKKTC
860 870 880 890 900
AHLFTATINL NSANDSWFGS LKDTIQHQQG EAVWVSEGKM EGMDDDPEDR
910 920 930 940 950
MSYLTAMGAD YLSCDSRLIS DFEDTDGEGG AYTDNELDEP AEEPLVSSIT
960 970 980 990 1000
RSSEPVQHEE SIRKPSPEPR AQMRRAASSD QLRDNSPPPA FKPEPPKAKT
1010 1020 1030 1040 1050
QNKEESYDFS KSYEYKSNPS AVAGNETPGA STKGYPPPVA AKPTFGRSIL
1060 1070 1080 1090 1100
KPSTPIPPQE GEEVGESSEE QDNAPKSVLG KVKIFEKMDH KARLQRMQEL
1110 1120 1130 1140 1150
QEAQNARIEI AQKHPDIYAV PIKTHKPDPG TPQHTSSRPP EPQKAPSRPY
1160 1170 1180 1190
QDTRGSYGSD AEEEEYRQQL SEHSKRGYYG QSARYRDTEL
Note: Produced by alternative promoter usage.
Length:1,190
Mass (Da):133,958
Last modified:January 11, 2011 - v2
Checksum:i27305B723043BF6C
GO
Isoform A2 (identifier: Q9UDY2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     961-1107: Missing.

Note: Produced by alternative splicing of isoform A1.
Show »
Length:1,043
Mass (Da):117,758
Checksum:i6EE97CE690160E91
GO
Isoform A3 (identifier: Q9UDY2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     961-993: SIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKP → VRRGRPRAGTGEPGVFLALSWTAVCSGCCGRHS
     994-1190: Missing.

Note: Produced by alternative splicing of isoform A1.
Show »
Length:993
Mass (Da):111,663
Checksum:iD469C9A73851A6D3
GO
Isoform C1 (identifier: Q9UDY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.

Note: Produced by alternative promoter usage.
Show »
Length:1,167
Mass (Da):131,368
Checksum:i91F7D588687D179E
GO
Isoform C2 (identifier: Q9UDY2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-23: Missing.
     961-1107: Missing.

Note: Produced by alternative splicing of isoform C1.
Show »
Length:1,020
Mass (Da):115,168
Checksum:i4A49BF3F0718D771
GO
Isoform 6 (identifier: Q9UDY2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MPVRGDRGFPPRRELSGWL → MKTAQALHRMWIQAVKKLRRWKG
     961-997: Missing.

Note: No experimental confirmation available.
Show »
Length:1,157
Mass (Da):130,446
Checksum:i30C98BC65E29BC85
GO
Isoform 7 (identifier: Q9UDY2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MPVRGDRGFPPRRELSGWLR → MKTAQALHRMWIQAVKKLRRWKGRVSPSASSPLVFPNLSSWEGEGSKTILT

Note: No experimental confirmation available.
Show »
Length:1,221
Mass (Da):137,342
Checksum:iE185339B2A2F37B4
GO

Sequence cautioni

The sequence AAA61300 differs from that shown. Reason: Frameshift at positions 1086, 1092 and 1095.IKR:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti411N → T in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti411N → T in AAM28524 (Ref. 3) IKR:1
Sequence conflicti718A → V in BAH13722 (PubMed:14702039).IKR:1
Sequence conflicti782I → V in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti782I → V in AAM28524 (Ref. 3) IKR:1
Sequence conflicti808P → S in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti812 – 814FFN → SFT in AAA61300 (PubMed:7951235).IKR:3
Sequence conflicti834K → N in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti842Q → H in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti996P → S in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti1093R → G in AAA61300 (PubMed:7951235).IKR:1
Sequence conflicti1110I → L in BAH13722 (PubMed:14702039).IKR:1
Sequence conflicti1136S → N in AAB41794 (Ref. 9) IKR:1
Sequence conflicti1155 – 1158GSYG → RSFC in AAB41794 (Ref. 9) IKR:4
Sequence conflicti1165 – 1167EYR → IRS in AAB41794 (Ref. 9) IKR:3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01600448V → A in FHCA. 1 PublicationCorresponds to variant dbSNP:rs121918299Ensembl.1
Natural variantiVAR_030798482D → END:4 PublicationsCorresponds to variant dbSNP:rs2309428Ensembl.1
Natural variantiVAR_046675668M → I1 PublicationCorresponds to variant dbSNP:rs34774441Ensembl.1
Natural variantiVAR_046676711S → P. Corresponds to variant dbSNP:rs35797487Ensembl.1
Natural variantiVAR_046677822K → N1 PublicationCorresponds to variant dbSNP:rs1049624Ensembl.1
Natural variantiVAR_046678829N → D1 PublicationCorresponds to variant dbSNP:rs1049625Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0069531 – 23Missing in isoform C1 and isoform C2. IKR:Add BLAST23
Alternative sequenceiVSP_0461141 – 20MPVRG…SGWLR → MKTAQALHRMWIQAVKKLRR WKGRVSPSASSPLVFPNLSS WEGEGSKTILT in isoform 7. IBD:Add BLAST20
Alternative sequenceiVSP_0461151 – 19MPVRG…LSGWL → MKTAQALHRMWIQAVKKLRR WKG in isoform 6. IBD:Add BLAST19
Alternative sequenceiVSP_003149961 – 1107Missing in isoform A2 and isoform C2. IKR:Add BLAST147
Alternative sequenceiVSP_046116961 – 997Missing in isoform 6. IBD:Add BLAST37
Alternative sequenceiVSP_007835961 – 993SIRKP…PAFKP → VRRGRPRAGTGEPGVFLALS WTAVCSGCCGRHS in isoform A3. IBD:Add BLAST33
Alternative sequenceiVSP_007836994 – 1190Missing in isoform A3. IBD:Add BLAST197

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27476 mRNA. Translation: AAA61300.1. Frameshift.
AF177533
, AF043195, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177530, AF177531, AF177532 Genomic DNA. Translation: AAD20387.2.
AF177533
, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177530, AF177531, AF177532 Genomic DNA. Translation: AAC02527.2.
AF177533
, AF043195, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177532 Genomic DNA. Translation: AAD56218.2.
AF177533
, AF043196, AF043197, AF177518, AF177519, AF177520, AF177521, AF177522, AF177523, AF177524, AF177525, AF177526, AF177527, AF177528, AF177529, AF177532 Genomic DNA. Translation: AAD56219.2.
AF489824 mRNA. Translation: AAM28524.1.
AK295034 mRNA. Translation: BAH11954.1.
AK302483 mRNA. Translation: BAH13722.1.
AL162730 Genomic DNA. No translation available.
AL358113 Genomic DNA. Translation: CAH70867.1.
AL358113 Genomic DNA. Translation: CAH70868.1.
AL358113 Genomic DNA. Translation: CAM13389.1.
AL590238 Genomic DNA. No translation available.
BC027592 mRNA. Translation: AAH27592.1.
AF083892 mRNA. Translation: AAC33121.1.
AF083893 mRNA. Translation: AAC33122.1.
U84581 mRNA. Translation: AAB41794.1.
CCDSiCCDS55315.1. [Q9UDY2-6]
CCDS55316.1. [Q9UDY2-7]
CCDS55317.1. [Q9UDY2-4]
CCDS6627.1. [Q9UDY2-1]
CCDS6628.1. [Q9UDY2-2]
PIRiI54378.
RefSeqiNP_001163886.1. NM_001170415.1. [Q9UDY2-6]
NP_001163887.1. NM_001170416.1. [Q9UDY2-7]
NP_004808.2. NM_004817.3. [Q9UDY2-1]
XP_011517508.1. XM_011519206.2. [Q9UDY2-3]
XP_011517509.1. XM_011519207.2. [Q9UDY2-3]
XP_011517510.1. XM_011519208.2. [Q9UDY2-3]
XP_011517511.1. XM_011519209.2. [Q9UDY2-3]
UniGeneiHs.50382.
Hs.736223.

Genome annotation databases

EnsembliENST00000348208; ENSP00000345893; ENSG00000119139. [Q9UDY2-2]
ENST00000377245; ENSP00000366453; ENSG00000119139. [Q9UDY2-1]
ENST00000453658; ENSP00000392178; ENSG00000119139. [Q9UDY2-4]
ENST00000535702; ENSP00000442090; ENSG00000119139. [Q9UDY2-6]
ENST00000539225; ENSP00000438262; ENSG00000119139. [Q9UDY2-7]
GeneIDi9414.
KEGGihsa:9414.
UCSCiuc004ahd.4. human. [Q9UDY2-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZO2_HUMAN
AccessioniPrimary (citable) accession number: Q9UDY2
Secondary accession number(s): A2A3H9
, B7Z2R8, B7Z7T6, F5H301, F5H886, Q15883, Q5VXL0, Q5VXL1, Q8N756, Q8NI14, Q99839, Q9UDY0, Q9UDY1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: January 11, 2011
Last modified: November 22, 2017
This is version 191 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families