Reviewed,
UniProtKB/Swiss-Prot Q9UDY2 (ZO2_HUMAN)
Last modified
November 3, 2009.
Version 105.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tight junction protein ZO-2 Alternative name(s): Zonula occludens protein 2 Zona occludens protein 2 Tight junction protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1190 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Plays a role in tight junctions and adherens junctions. |
| Subunit structure | Homodimer, and heterodimer with ZO1. Interacts with occludin, SAFB and UBN1. Interaction with SAFB occurs in the nucleus. Interacts with SCRIB. Ref.10 Ref.21 Ref.23 |
| Subcellular location | Cell junction › adherens junction. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cell junction › tight junction By similarity. Nucleus By similarity. Note: Also nuclear under environmental stress conditions and in migratory endothelial cells and subconfluent epithelial cell cultures By similarity. |
| Tissue specificity | This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain whereas isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. In brain and skeletal muscle, only isoform A1 is detectable. Isoform C1 is found in normal as well as in most neoplastic tissues while isoform A1 is present almost exclusively in normal tissue. |
| Involvement in disease | Defects in TJP2 are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption. Ref.24 |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
| Sequence caution | The sequence AAA61300.1 differs from that shown. Reason: Frameshift at positions 1086, 1092 and 1095. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cell membrane Membrane Nucleus Tight junction |
| Coding sequence diversity | Alternative promoter usage Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Domain | Repeat SH3 domain |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | adherens junction Inferred from electronic annotation. Source: UniProtKB-SubCell cytoplasmInferred from direct assay. Source: HPA internal side of plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell tight junctionInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | guanylate kinase activity Traceable author statement. Source: ProtInc protein binding Ref.10Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TRAF6 | Q9Y4K3 | 1 | EBI-1042602,EBI-359276 | |
| YWHAB | P31946 | 1 | EBI-1042602,EBI-359815 | |
| YWHAG | P61981 | 1 | EBI-1042602,EBI-359832 | |
| YWHAQ | P27348 | 1 | EBI-1042602,EBI-359854 | |
| YWHAZ | P63104 | 1 | EBI-1042602,EBI-347088 |
Alternative products
| This entry describes 5 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform A1 (identifier: Q9UDY2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform A2 (identifier: Q9UDY2-2) The sequence of this isoform differs from the canonical sequence as follows: 961-1108: Missing. | ||||||
| Note: Produced by alternative splicing of isoform A1. | ||||||
| Isoform A3 (identifier: Q9UDY2-5) The sequence of this isoform differs from the canonical sequence as follows: 961-993: SIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKP → VRRGRPRAGTGEPGVFLALSWTAVCSGCCGRHS 994-1190: Missing. | ||||||
| Note: Produced by alternative splicing of isoform A1. | ||||||
| Isoform C1 (identifier: Q9UDY2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-23: Missing. | ||||||
| Note: Produced by alternative promoter usage. | ||||||
| Isoform C2 (identifier: Q9UDY2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-23: Missing. 961-1108: Missing. | ||||||
| Note: Produced by alternative splicing of isoform C1. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||
Molecule processing | |||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1190 | 1190 | Tight junction protein ZO-2 | PRO_0000094543 | |||||||||||||||||||
Regions | |||||||||||||||||||||||
| Domain | 33 – 120 | 88 | PDZ 1 | ||||||||||||||||||||
| Domain | 307 – 385 | 79 | PDZ 2 | ||||||||||||||||||||
| Domain | 509 – 590 | 82 | PDZ 3 | ||||||||||||||||||||
| Domain | 604 – 669 | 66 | SH3 | ||||||||||||||||||||
| Domain | 678 – 876 | 199 | Guanylate kinase-like | ||||||||||||||||||||
| Region | 1188 – 1190 | 3 | Interaction with SCRIB | ||||||||||||||||||||
| Compositional bias | 1162 – 1165 | 4 | Poly-Glu | ||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||
| Modified residue | 130 | 1 | Phosphoserine Ref.13 Ref.18 | ||||||||||||||||||||
| Modified residue | 168 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||
| Modified residue | 170 | 1 | Phosphoserine Ref.13 Ref.18 Ref.17 Ref.11 | ||||||||||||||||||||
| Modified residue | 174 | 1 | Phosphoserine Ref.18 Ref.17 Ref.11 | ||||||||||||||||||||
| Modified residue | 192 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||
| Modified residue | 244 | 1 | Phosphoserine Ref.13 Ref.18 Ref.17 Ref.11 | ||||||||||||||||||||
| Modified residue | 261 | 1 | Phosphotyrosine Ref.15 | ||||||||||||||||||||
| Modified residue | 265 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||
| Modified residue | 266 | 1 | Phosphoserine Ref.18 Ref.17 Ref.9 Ref.14 | ||||||||||||||||||||
| Modified residue | 292 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 294 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 296 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||
| Modified residue | 394 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||
| Modified residue | 398 | 1 | Phosphoserine Ref.13 Ref.18 | ||||||||||||||||||||
| Modified residue | 400 | 1 | Phosphoserine Ref.13 Ref.18 | ||||||||||||||||||||
| Modified residue | 415 | 1 | Phosphoserine Ref.17 Ref.11 | ||||||||||||||||||||
| Modified residue | 426 | 1 | Phosphotyrosine Ref.22 | ||||||||||||||||||||
| Modified residue | 440 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||
| Modified residue | 441 | 1 | Phosphoserine Ref.13 | ||||||||||||||||||||
| Modified residue | 445 | 1 | Phosphothreonine Ref.13 | ||||||||||||||||||||
| Modified residue | 455 | 1 | Phosphothreonine Ref.18 | ||||||||||||||||||||
| Modified residue | 574 | 1 | Phosphotyrosine Ref.12 | ||||||||||||||||||||
| Modified residue | 702 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||
| Modified residue | 920 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||
| Modified residue | 925 | 1 | Phosphothreonine Ref.18 | ||||||||||||||||||||
| Modified residue | 933 | 1 | Phosphothreonine Ref.18 | ||||||||||||||||||||
| Modified residue | 966 | 1 | Phosphoserine Ref.17 | ||||||||||||||||||||
| Modified residue | 978 | 1 | Phosphoserine Ref.18 Ref.17 | ||||||||||||||||||||
| Modified residue | 986 | 1 | Phosphoserine Ref.13 Ref.18 Ref.17 | ||||||||||||||||||||
| Modified residue | 1006 | 1 | Phosphoserine By similarity | ||||||||||||||||||||
| Modified residue | 1067 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||
| Modified residue | 1068 | 1 | Phosphoserine Ref.18 | ||||||||||||||||||||
| Modified residue | 1118 | 1 | Phosphotyrosine Ref.15 Ref.22 | ||||||||||||||||||||
| Modified residue | 1131 | 1 | Phosphothreonine Ref.18 Ref.16 | ||||||||||||||||||||
| Modified residue | 1159 | 1 | Phosphoserine Ref.18 Ref.17 Ref.9 Ref.19 | ||||||||||||||||||||
Natural variations | |||||||||||||||||||||||
| Alternative sequence | 1 – 23 | 23 | Missing in isoform C1 and isoform C2. | VSP_006953 | |||||||||||||||||||
| Alternative sequence | 961 – 1108 | 148 | Missing in isoform A2 and isoform C2. | VSP_003149 | |||||||||||||||||||
| Alternative sequence | 961 – 993 | 33 | SIRKP…PAFKP → VRRGRPRAGTGEPGVFLALS WTAVCSGCCGRHS in isoform A3. | VSP_007835 | |||||||||||||||||||
| Alternative sequence | 994 – 1190 | 197 | Missing in isoform A3. | VSP_007836 | |||||||||||||||||||
| Natural variant | 48 | 1 | V → A in FHCA. Ref.24 | VAR_016004 | |||||||||||||||||||
| Natural variant | 482 | 1 | E → D: dbSNP rs2309428. Ref.4 Ref.5 | VAR_030798 | |||||||||||||||||||
| Natural variant | 668 | 1 | M → I: dbSNP rs34774441. | VAR_046675 | |||||||||||||||||||
| Natural variant | 711 | 1 | S → P: dbSNP rs35797487. | VAR_046676 | |||||||||||||||||||
| Natural variant | 822 | 1 | K → N: dbSNP rs1049624. Ref.1 | VAR_046677 | |||||||||||||||||||
| Natural variant | 829 | 1 | N → D: dbSNP rs1049625. Ref.1 | VAR_046678 | |||||||||||||||||||
Experimental info | |||||||||||||||||||||||
| Sequence conflict | 411 | 1 | N → T in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 411 | 1 | N → T in AAM28524. Ref.3 | ||||||||||||||||||||
| Sequence conflict | 782 | 1 | I → V in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 782 | 1 | I → V in AAM28524. Ref.3 | ||||||||||||||||||||
| Sequence conflict | 808 | 1 | P → S in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 812 – 814 | 3 | FFN → SFT in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 834 | 1 | K → N in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 842 | 1 | Q → H in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 996 | 1 | P → S in AAA61300. Ref.1 | ||||||||||||||||||||
| Sequence conflict | 1136 | 1 | S → N in AAB41794. Ref.8 | ||||||||||||||||||||
| Sequence conflict | 1155 – 1158 | 4 | GSYG → RSFC in AAB41794. Ref.8 | ||||||||||||||||||||
| Sequence conflict | 1165 – 1167 | 3 | EYR → IRS Ref.8 | ||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||
| Beta strand | 306 – 311 | 6 | |||||||||||||||||||||
| Beta strand | 315 – 317 | 3 | |||||||||||||||||||||
| Beta strand | 321 – 332 | 12 | |||||||||||||||||||||
| Helix | 337 – 341 | 5 | |||||||||||||||||||||
| Beta strand | 349 – 353 | 5 | |||||||||||||||||||||
| Helix | 363 – 372 | 10 | |||||||||||||||||||||
| Beta strand | 375 – 381 | 7 | |||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The Friedreich ataxia region: characterization of two novel genes and reduction of the critical region to 300 kb." Duclos F., Rodius F., Wrogemann K., Mandel J.-L., Koenig M. Hum. Mol. Genet. 3:909-914(1994) [PubMed: 7951235] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A1), VARIANTS ASN-822 AND ASP-829. Tissue: Brain. |
| [2] | "Organization and expression of the human zo-2 gene (tjp-2) in normal and neoplastic tissues." Chlenski A., Ketels K.V., Korovaitseva G.I., Talamonti M.S., Oyasu R., Scarpelli D.G. Biochim. Biophys. Acta 1493:319-324(2000) [PubMed: 11018256] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS A1; C1; A2 AND C2), ALTERNATIVE PROMOTER USAGE. Tissue: Pancreas. |
| [3] | "LIM protein KyoT2 interacts with human tight junction protein ZO-2-i3." Yan H.H., Rong L., Qiang S., Jian W., Peng Z., Hua H., Hui Z.W. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A3). |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASP-482. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A1), VARIANT ASP-482. Tissue: Testis. |
| [6] | "Tight junction protein ZO-2 is differentially expressed in normal pancreatic ducts compared to human pancreatic adenocarcinoma." Chlenski A., Ketels K.V., Tsao M.-S., Talamonti M.S., Anderson M.R., Oyasu R., Scarpelli D.G. Int. J. Cancer 82:137-144(1999) [PubMed: 10360833] [Abstract] Cited for: NUCLEOTIDE SEQUENCE OF 1-104 (ISOFORMS A1 AND C1). Tissue: Pancreas. |
| [7] | "Zo-2 gene alternative promoters in normal and neoplastic human pancreatic duct cells." Chlenski A., Ketels K.V., Engeriser J.L., Talamonti M.S., Tsao M.-S., Koutnikova H., Oyasu R., Scarpelli D.G. Int. J. Cancer 83:349-358(1999) [PubMed: 10495427] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE (ISOFORMS A1 AND C1), ALTERNATIVE PROMOTER USAGE. Tissue: Pancreas. |
| [8] | Adams L.D., Werny I., Schwartz S.M. Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE OF 1047-1167. Tissue: Aortic smooth muscle. |
| [9] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-266; SER-296 AND SER-1159, MASS SPECTROMETRY. Tissue: Epithelium. |
| [10] | "hScrib interacts with ZO-2 at the cell-cell junctions of epithelial cells." Metais J.-Y., Navarro C., Santoni M.-J., Audebert S., Borg J.-P. FEBS Lett. 579:3725-3730(2005) [PubMed: 15975580] [Abstract] Cited for: INTERACTION WITH SCRIB. |
| [11] | "Global phosphoproteome of HT-29 human colon adenocarcinoma cells." Kim J.-E., Tannenbaum S.R., White F.M. J. Proteome Res. 4:1339-1346(2005) [PubMed: 16083285] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-170; SER-174; SER-244 AND SER-415, MASS SPECTROMETRY. |
| [12] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed: 15592455] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-574, MASS SPECTROMETRY. |
| [13] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130; SER-170; SER-192; SER-244; SER-394; SER-398; SER-400; SER-440; SER-441; THR-445 AND SER-986, MASS SPECTROMETRY. Tissue: Epithelium. |
| [14] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed: 16964243] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-266, MASS SPECTROMETRY. Tissue: Epithelium. |
| [15] | "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer." Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J., Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L., Mitchell J., Wetzel R., Macneill J., Ren J.M. Comb M.J.Cell 131:1190-1203(2007) [PubMed: 18083107] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-261 AND TYR-1118, MASS SPECTROMETRY. |
| [16] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1131, MASS SPECTROMETRY. |
| [17] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168; SER-170; SER-174; SER-244; SER-266; SER-415; SER-702; SER-966; SER-978; SER-986 AND SER-1159, MASS SPECTROMETRY. Tissue: Platelet. |
| [18] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130; SER-170; SER-174; SER-244; SER-266; SER-398; SER-400; THR-455; SER-920; THR-925; THR-933; SER-978; SER-986; SER-1067; SER-1068; THR-1131 AND SER-1159, MASS SPECTROMETRY. |
| [19] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed: 18318008] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1159, MASS SPECTROMETRY. Tissue: Liver. |
| [20] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [21] | "Characterization of the ubinuclein protein as a new member of the nuclear and adhesion complex components (NACos)." Aho S., Lupo J., Coly P.-A., Sabine A., Castellazzi M., Morand P., Sergeant A., Manet E., Boyer V., Gruffat H. Biol. Cell 101:319-334(2009) [PubMed: 18823282] [Abstract] Cited for: INTERACTION WITH UBN1. |
| [22] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-426 AND TYR-1118, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [23] | "Domain-swapped dimerization of the second PDZ domain of ZO2 may provide a structural basis for the polymerization of claudins." Wu J., Yang Y., Zhang J., Ji P., Du W., Jiang P., Xie D., Huang H., Wu M., Zhang G., Wu J., Shi Y. J. Biol. Chem. 282:35988-35999(2007) [PubMed: 17897942] [Abstract] Cited for: STRUCTURE BY NMR OF 306-385, SUBUNIT. |
| [24] | "Complex inheritance of familial hypercholanemia with associated mutations in TJP2 and BAAT." Carlton V.E.H., Harris B.Z., Puffenberger E.G., Batta A.K., Knisely A.S., Robinson D.L., Strauss K.A., Shneider B.L., Lim W.A., Salen G., Morton D.H., Bull L.N. Nat. Genet. 34:91-96(2003) [PubMed: 12704386] [Abstract] Cited for: VARIANT FHCA ALA-48. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| L27476 mRNA. Translation: AAA61300.1. Frameshift. AF177533 AF177532 Genomic DNA. Translation: AAD20387.2. AF177533 AF177532 Genomic DNA. Translation: AAC02527.2. AF177533 AF177532 Genomic DNA. Translation: AAD56218.2. AF177533 AF177532 Genomic DNA. Translation: AAD56219.2. AF489824 mRNA. Translation: AAM28524.1. AL358113 Genomic DNA. Translation: CAH70868.1. BC027592 mRNA. Translation: AAH27592.1. AF083892 mRNA. Translation: AAC33121.1. AF083893 mRNA. Translation: AAC33122.1. U84581 mRNA. Translation: AAB41794.1. | |||||||||||||||||||
| IPI | IPI00003843. IPI00216245. IPI00216246. IPI00332453. IPI00797934. | ||||||||||||||||||
| PIR | I54378. | ||||||||||||||||||
| RefSeq | NP_004808.2. NP_963923.1. | ||||||||||||||||||
| UniGene | Hs.50382 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| SMR | Q9UDY2. Positions 21-129. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9UDY2. 5 interactions. | ||||||||||||||||||
| STRING | Q9UDY2. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9UDY2. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q9UDY2. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000265384; ENSP00000265384; ENSG00000119139; Homo sapiens. [Genome view] ENST00000348208; ENSP00000345893; ENSG00000119139; Homo sapiens. [Genome view] ENST00000377245; ENSP00000366453; ENSG00000119139; Homo sapiens. [Genome view] ENST00000377259; ENSP00000366469; ENSG00000119139; Homo sapiens. [Genome view] ENST00000423935; ENSP00000402941; ENSG00000119139; Homo sapiens. [Genome view] ENST00000453658; ENSP00000392178; ENSG00000119139; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 9414. | ||||||||||||||||||
| KEGG | hsa:9414. | ||||||||||||||||||
| UCSC | uc004ahe.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 9414. | ||||||||||||||||||
| GeneCards | GC09P070956. | ||||||||||||||||||
| H-InvDB | HIX0079048. | ||||||||||||||||||
| HGNC | HGNC:11828. TJP2. | ||||||||||||||||||
| HPA | CAB009228. HPA001813. | ||||||||||||||||||
| MIM | 607709. gene. 607748. phenotype. | ||||||||||||||||||
| PharmGKB | PA36533. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | Q9UDY2. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9UDY2. | ||||||||||||||||||
| Bgee | Q9UDY2. | ||||||||||||||||||
| CleanEx | HS_TJP2. | ||||||||||||||||||
| Genevestigator | Q9UDY2. | ||||||||||||||||||
| GermOnline | ENSG00000119139. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR020590. Guanylate_kinase_CS. IPR008145. Guanylt/Ca. IPR001478. PDZ/DHR/GLGF. IPR011511. SH3_2. IPR001452. SH3_domain. IPR005417. ZonOcculdens. IPR005419. ZonOcculS2. [Graphical view] | ||||||||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF00595. PDZ. 3 hits. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR01597. ZONOCCLUDNS. PR01599. ZONOCCLUDNS2. | ||||||||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. False negative. PS50052. GUANYLATE_KINASE_2. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 35268. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ZO2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UDY2 Secondary accession number(s): Q15883 Q9UDY1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


