SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UBV4

- WNT16_HUMAN

UniProt

Q9UBV4 - WNT16_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein Wnt-16
Gene
WNT16
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters By similarity.

GO - Molecular functioni

  1. frizzled binding Source: RefGenome

GO - Biological processi

  1. Wnt signaling pathway Source: RefGenome
  2. cardiac epithelial to mesenchymal transition Source: Ensembl
  3. cell fate commitment Source: RefGenome
  4. keratinocyte differentiation Source: BHF-UCL
  5. keratinocyte proliferation Source: BHF-UCL
  6. negative regulation of cell death Source: BHF-UCL
  7. neuron differentiation Source: RefGenome
  8. optic cup formation involved in camera-type eye development Source: BHF-UCL
  9. oxidative stress-induced premature senescence Source: BHF-UCL
  10. positive regulation of JNK cascade Source: BHF-UCL
  11. positive regulation of gene expression Source: BHF-UCL
  12. positive regulation of phosphatidylinositol 3-kinase signaling Source: BHF-UCL
  13. replicative senescence Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Wnt signaling pathway

Enzyme and pathway databases

ReactomeiREACT_163710. WNT ligand biogenesis and trafficking.
REACT_18372. Class B/2 (Secretin family receptors).
SignaLinkiQ9UBV4.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Wnt-16
Gene namesi
Name:WNT16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:16267. WNT16.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: BHF-UCL
  2. extracellular region Source: Reactome
  3. extracellular space Source: BHF-UCL
  4. proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38105.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929 Reviewed prediction
Add
BLAST
Chaini30 – 365336Protein Wnt-16
PRO_0000041471Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi81 ↔ 92 By similarity
Disulfide bondi139 ↔ 147 By similarity
Glycosylationi143 – 1431N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi149 ↔ 168 By similarity
Glycosylationi189 – 1891N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi221 ↔ 235 By similarity
Disulfide bondi223 ↔ 230 By similarity
Lipidationi227 – 2271O-palmitoyl serine; by PORCN By similarity
Disulfide bondi310 ↔ 325 By similarity
Glycosylationi311 – 3111N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi340 ↔ 355 By similarity
Disulfide bondi342 ↔ 352 By similarity
Disulfide bondi347 ↔ 348 By similarity

Post-translational modificationi

Palmitoylation at Ser-227 is required for efficient binding to frizzled receptors. Palmitoylation is necessary for proper trafficking to cell surface By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiQ9UBV4.
PRIDEiQ9UBV4.

PTM databases

PhosphoSiteiQ9UBV4.

Expressioni

Tissue specificityi

Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.

Gene expression databases

ArrayExpressiQ9UBV4.
BgeeiQ9UBV4.
CleanExiHS_WNT16.
GenevestigatoriQ9UBV4.

Organism-specific databases

HPAiHPA027030.

Interactioni

Protein-protein interaction databases

BioGridi119514. 1 interaction.
IntActiQ9UBV4. 1 interaction.
STRINGi9606.ENSP00000222462.

Structurei

3D structure databases

ProteinModelPortaliQ9UBV4.
SMRiQ9UBV4. Positions 72-294.

Family & Domainsi

Sequence similaritiesi

Belongs to the Wnt family.

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG238376.
HOGENOMiHOG000039529.
HOVERGENiHBG001595.
InParanoidiQ9UBV4.
KOiK01558.
OMAiCWKTMSS.
OrthoDBiEOG7C8GJ8.
PhylomeDBiQ9UBV4.
TreeFamiTF105310.

Family and domain databases

InterProiIPR005817. Wnt.
IPR013304. Wnt16.
IPR018161. Wnt_CS.
[Graphical view]
PANTHERiPTHR12027. PTHR12027. 1 hit.
PfamiPF00110. wnt. 1 hit.
[Graphical view]
PRINTSiPR01895. WNT16PROTEIN.
PR01349. WNTPROTEIN.
SMARTiSM00097. WNT1. 1 hit.
[Graphical view]
PROSITEiPS00246. WNT1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Wnt-16b (identifier: Q9UBV4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDRAALLGLA RLCALWAALL VLFPYGAQGN WMWLGIASFG VPEKLGCANL    50
PLNSRQKELC KRKPYLLPSI REGARLGIQE CGSQFRHERW NCMITAAATT 100
APMGASPLFG YELSSGTKET AFIYAVMAAG LVHSVTRSCS AGNMTECSCD 150
TTLQNGGSAS EGWHWGGCSD DVQYGMWFSR KFLDFPIGNT TGKENKVLLA 200
MNLHNNEAGR QAVAKLMSVD CRCHGVSGSC AVKTCWKTMS SFEKIGHLLK 250
DKYENSIQIS DKTKRKMRRR EKDQRKIPIH KDDLLYVNKS PNYCVEDKKL 300
GIPGTQGREC NRTSEGADGC NLLCCGRGYN THVVRHVERC ECKFIWCCYV 350
RCRRCESMTD VHTCK 365
Length:365
Mass (Da):40,690
Last modified:May 1, 2000 - v1
Checksum:i313A26D8FFBCC56F
GO
Isoform Wnt-16a (identifier: Q9UBV4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MDRAALLGLARLCALWAALLVLFPYGAQGNWM → MERHPPMQLTTCLRETLFTGASQKTSLW

Show »
Length:361
Mass (Da):40,447
Checksum:i9C823B8C92850BBF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti82 – 821G → R.1 Publication
Corresponds to variant rs2908004 [ dbSNP | Ensembl ].
VAR_052957
Natural varianti126 – 1261V → M in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036289
Natural varianti263 – 2631T → I.1 Publication
Corresponds to variant rs2707466 [ dbSNP | Ensembl ].
VAR_052958

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MDRAA…QGNWM → MERHPPMQLTTCLRETLFTG ASQKTSLW in isoform Wnt-16a.
VSP_006797Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF169963 mRNA. Translation: AAD49351.1.
AF152584 mRNA. Translation: AAD38052.1.
AC006364 Genomic DNA. No translation available.
BC104919 mRNA. Translation: AAI04920.1.
BC104945 mRNA. Translation: AAI04946.1.
CCDSiCCDS5781.1. [Q9UBV4-1]
RefSeqiNP_057171.2. NM_016087.2.
NP_476509.1. NM_057168.1. [Q9UBV4-1]
UniGeneiHs.272375.

Genome annotation databases

EnsembliENST00000222462; ENSP00000222462; ENSG00000002745. [Q9UBV4-1]
GeneIDi51384.
KEGGihsa:51384.
UCSCiuc003vjw.3. human. [Q9UBV4-1]

Polymorphism databases

DMDMi12643875.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF169963 mRNA. Translation: AAD49351.1 .
AF152584 mRNA. Translation: AAD38052.1 .
AC006364 Genomic DNA. No translation available.
BC104919 mRNA. Translation: AAI04920.1 .
BC104945 mRNA. Translation: AAI04946.1 .
CCDSi CCDS5781.1. [Q9UBV4-1 ]
RefSeqi NP_057171.2. NM_016087.2.
NP_476509.1. NM_057168.1. [Q9UBV4-1 ]
UniGenei Hs.272375.

3D structure databases

ProteinModelPortali Q9UBV4.
SMRi Q9UBV4. Positions 72-294.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119514. 1 interaction.
IntActi Q9UBV4. 1 interaction.
STRINGi 9606.ENSP00000222462.

PTM databases

PhosphoSitei Q9UBV4.

Polymorphism databases

DMDMi 12643875.

Proteomic databases

PaxDbi Q9UBV4.
PRIDEi Q9UBV4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000222462 ; ENSP00000222462 ; ENSG00000002745 . [Q9UBV4-1 ]
GeneIDi 51384.
KEGGi hsa:51384.
UCSCi uc003vjw.3. human. [Q9UBV4-1 ]

Organism-specific databases

CTDi 51384.
GeneCardsi GC07P120965.
HGNCi HGNC:16267. WNT16.
HPAi HPA027030.
MIMi 606267. gene.
neXtProti NX_Q9UBV4.
PharmGKBi PA38105.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG238376.
HOGENOMi HOG000039529.
HOVERGENi HBG001595.
InParanoidi Q9UBV4.
KOi K01558.
OMAi CWKTMSS.
OrthoDBi EOG7C8GJ8.
PhylomeDBi Q9UBV4.
TreeFami TF105310.

Enzyme and pathway databases

Reactomei REACT_163710. WNT ligand biogenesis and trafficking.
REACT_18372. Class B/2 (Secretin family receptors).
SignaLinki Q9UBV4.

Miscellaneous databases

GeneWikii WNT16.
GenomeRNAii 51384.
NextBioi 54895.
PROi Q9UBV4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UBV4.
Bgeei Q9UBV4.
CleanExi HS_WNT16.
Genevestigatori Q9UBV4.

Family and domain databases

InterProi IPR005817. Wnt.
IPR013304. Wnt16.
IPR018161. Wnt_CS.
[Graphical view ]
PANTHERi PTHR12027. PTHR12027. 1 hit.
Pfami PF00110. wnt. 1 hit.
[Graphical view ]
PRINTSi PR01895. WNT16PROTEIN.
PR01349. WNTPROTEIN.
SMARTi SM00097. WNT1. 1 hit.
[Graphical view ]
PROSITEi PS00246. WNT1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Oncogenic homeodomain transcription factor E2A-Pbx1 activates a novel WNT gene in pre-B acute lymphoblastoid leukemia."
    McWhirter J.R., Neuteboom S.T., Wancewicz E.V., Monia B.P., Downing J.R., Murre C.
    Proc. Natl. Acad. Sci. U.S.A. 96:11464-11469(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16B).
  2. "Wnt-16a, a novel Wnt-16 isoform, which shows differential expression in adult human tissues."
    Fear M.W., Kelsell D.P., Spurr N.K., Barnes M.R.
    Biochem. Biophys. Res. Commun. 278:814-820(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16A), VARIANTS ARG-82 AND ILE-263.
    Tissue: Placenta.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM WNT-16B).
  5. Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-126.

Entry informationi

Entry nameiWNT16_HUMAN
AccessioniPrimary (citable) accession number: Q9UBV4
Secondary accession number(s): Q2M3G1, Q9Y5C0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: September 3, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi