Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UBV4

- WNT16_HUMAN

UniProt

Q9UBV4 - WNT16_HUMAN

Protein

Protein Wnt-16

Gene

WNT16

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters By similarity.By similarity

    GO - Molecular functioni

    1. frizzled binding Source: RefGenome

    GO - Biological processi

    1. cardiac epithelial to mesenchymal transition Source: Ensembl
    2. cell fate commitment Source: RefGenome
    3. keratinocyte differentiation Source: BHF-UCL
    4. keratinocyte proliferation Source: BHF-UCL
    5. negative regulation of cell death Source: BHF-UCL
    6. neuron differentiation Source: RefGenome
    7. optic cup formation involved in camera-type eye development Source: BHF-UCL
    8. oxidative stress-induced premature senescence Source: BHF-UCL
    9. positive regulation of gene expression Source: BHF-UCL
    10. positive regulation of JNK cascade Source: BHF-UCL
    11. positive regulation of phosphatidylinositol 3-kinase signaling Source: BHF-UCL
    12. replicative senescence Source: BHF-UCL
    13. Wnt signaling pathway Source: RefGenome

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Wnt signaling pathway

    Enzyme and pathway databases

    ReactomeiREACT_163710. WNT ligand biogenesis and trafficking.
    REACT_18372. Class B/2 (Secretin family receptors).
    SignaLinkiQ9UBV4.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein Wnt-16
    Gene namesi
    Name:WNT16
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:16267. WNT16.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: BHF-UCL
    2. extracellular region Source: Reactome
    3. extracellular space Source: BHF-UCL
    4. proteinaceous extracellular matrix Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38105.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 365336Protein Wnt-16PRO_0000041471Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi81 ↔ 92By similarity
    Disulfide bondi139 ↔ 147By similarity
    Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi149 ↔ 168By similarity
    Glycosylationi189 – 1891N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi221 ↔ 235By similarity
    Disulfide bondi223 ↔ 230By similarity
    Lipidationi227 – 2271O-palmitoyl serine; by PORCNBy similarity
    Disulfide bondi310 ↔ 325By similarity
    Glycosylationi311 – 3111N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi340 ↔ 355By similarity
    Disulfide bondi342 ↔ 352By similarity
    Disulfide bondi347 ↔ 348By similarity

    Post-translational modificationi

    Palmitoylation at Ser-227 is required for efficient binding to frizzled receptors. Palmitoylation is necessary for proper trafficking to cell surface By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

    Proteomic databases

    PaxDbiQ9UBV4.
    PRIDEiQ9UBV4.

    PTM databases

    PhosphoSiteiQ9UBV4.

    Expressioni

    Tissue specificityi

    Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.

    Gene expression databases

    ArrayExpressiQ9UBV4.
    BgeeiQ9UBV4.
    CleanExiHS_WNT16.
    GenevestigatoriQ9UBV4.

    Organism-specific databases

    HPAiHPA027030.

    Interactioni

    Protein-protein interaction databases

    BioGridi119514. 1 interaction.
    IntActiQ9UBV4. 1 interaction.
    STRINGi9606.ENSP00000222462.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UBV4.
    SMRiQ9UBV4. Positions 72-294.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the Wnt family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG238376.
    HOGENOMiHOG000039529.
    HOVERGENiHBG001595.
    InParanoidiQ9UBV4.
    KOiK01558.
    OMAiCWKTMSS.
    OrthoDBiEOG7C8GJ8.
    PhylomeDBiQ9UBV4.
    TreeFamiTF105310.

    Family and domain databases

    InterProiIPR005817. Wnt.
    IPR013304. Wnt16.
    IPR018161. Wnt_CS.
    [Graphical view]
    PANTHERiPTHR12027. PTHR12027. 1 hit.
    PfamiPF00110. wnt. 1 hit.
    [Graphical view]
    PRINTSiPR01895. WNT16PROTEIN.
    PR01349. WNTPROTEIN.
    SMARTiSM00097. WNT1. 1 hit.
    [Graphical view]
    PROSITEiPS00246. WNT1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Wnt-16b (identifier: Q9UBV4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDRAALLGLA RLCALWAALL VLFPYGAQGN WMWLGIASFG VPEKLGCANL    50
    PLNSRQKELC KRKPYLLPSI REGARLGIQE CGSQFRHERW NCMITAAATT 100
    APMGASPLFG YELSSGTKET AFIYAVMAAG LVHSVTRSCS AGNMTECSCD 150
    TTLQNGGSAS EGWHWGGCSD DVQYGMWFSR KFLDFPIGNT TGKENKVLLA 200
    MNLHNNEAGR QAVAKLMSVD CRCHGVSGSC AVKTCWKTMS SFEKIGHLLK 250
    DKYENSIQIS DKTKRKMRRR EKDQRKIPIH KDDLLYVNKS PNYCVEDKKL 300
    GIPGTQGREC NRTSEGADGC NLLCCGRGYN THVVRHVERC ECKFIWCCYV 350
    RCRRCESMTD VHTCK 365
    Length:365
    Mass (Da):40,690
    Last modified:May 1, 2000 - v1
    Checksum:i313A26D8FFBCC56F
    GO
    Isoform Wnt-16a (identifier: Q9UBV4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-32: MDRAALLGLARLCALWAALLVLFPYGAQGNWM → MERHPPMQLTTCLRETLFTGASQKTSLW

    Show »
    Length:361
    Mass (Da):40,447
    Checksum:i9C823B8C92850BBF
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti82 – 821G → R.1 Publication
    Corresponds to variant rs2908004 [ dbSNP | Ensembl ].
    VAR_052957
    Natural varianti126 – 1261V → M in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_036289
    Natural varianti263 – 2631T → I.1 Publication
    Corresponds to variant rs2707466 [ dbSNP | Ensembl ].
    VAR_052958

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3232MDRAA…QGNWM → MERHPPMQLTTCLRETLFTG ASQKTSLW in isoform Wnt-16a. 1 PublicationVSP_006797Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF169963 mRNA. Translation: AAD49351.1.
    AF152584 mRNA. Translation: AAD38052.1.
    AC006364 Genomic DNA. No translation available.
    BC104919 mRNA. Translation: AAI04920.1.
    BC104945 mRNA. Translation: AAI04946.1.
    CCDSiCCDS5781.1. [Q9UBV4-1]
    RefSeqiNP_057171.2. NM_016087.2.
    NP_476509.1. NM_057168.1. [Q9UBV4-1]
    UniGeneiHs.272375.

    Genome annotation databases

    EnsembliENST00000222462; ENSP00000222462; ENSG00000002745. [Q9UBV4-1]
    GeneIDi51384.
    KEGGihsa:51384.
    UCSCiuc003vjw.3. human. [Q9UBV4-1]

    Polymorphism databases

    DMDMi12643875.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF169963 mRNA. Translation: AAD49351.1 .
    AF152584 mRNA. Translation: AAD38052.1 .
    AC006364 Genomic DNA. No translation available.
    BC104919 mRNA. Translation: AAI04920.1 .
    BC104945 mRNA. Translation: AAI04946.1 .
    CCDSi CCDS5781.1. [Q9UBV4-1 ]
    RefSeqi NP_057171.2. NM_016087.2.
    NP_476509.1. NM_057168.1. [Q9UBV4-1 ]
    UniGenei Hs.272375.

    3D structure databases

    ProteinModelPortali Q9UBV4.
    SMRi Q9UBV4. Positions 72-294.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119514. 1 interaction.
    IntActi Q9UBV4. 1 interaction.
    STRINGi 9606.ENSP00000222462.

    PTM databases

    PhosphoSitei Q9UBV4.

    Polymorphism databases

    DMDMi 12643875.

    Proteomic databases

    PaxDbi Q9UBV4.
    PRIDEi Q9UBV4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000222462 ; ENSP00000222462 ; ENSG00000002745 . [Q9UBV4-1 ]
    GeneIDi 51384.
    KEGGi hsa:51384.
    UCSCi uc003vjw.3. human. [Q9UBV4-1 ]

    Organism-specific databases

    CTDi 51384.
    GeneCardsi GC07P120965.
    HGNCi HGNC:16267. WNT16.
    HPAi HPA027030.
    MIMi 606267. gene.
    neXtProti NX_Q9UBV4.
    PharmGKBi PA38105.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG238376.
    HOGENOMi HOG000039529.
    HOVERGENi HBG001595.
    InParanoidi Q9UBV4.
    KOi K01558.
    OMAi CWKTMSS.
    OrthoDBi EOG7C8GJ8.
    PhylomeDBi Q9UBV4.
    TreeFami TF105310.

    Enzyme and pathway databases

    Reactomei REACT_163710. WNT ligand biogenesis and trafficking.
    REACT_18372. Class B/2 (Secretin family receptors).
    SignaLinki Q9UBV4.

    Miscellaneous databases

    GeneWikii WNT16.
    GenomeRNAii 51384.
    NextBioi 54895.
    PROi Q9UBV4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UBV4.
    Bgeei Q9UBV4.
    CleanExi HS_WNT16.
    Genevestigatori Q9UBV4.

    Family and domain databases

    InterProi IPR005817. Wnt.
    IPR013304. Wnt16.
    IPR018161. Wnt_CS.
    [Graphical view ]
    PANTHERi PTHR12027. PTHR12027. 1 hit.
    Pfami PF00110. wnt. 1 hit.
    [Graphical view ]
    PRINTSi PR01895. WNT16PROTEIN.
    PR01349. WNTPROTEIN.
    SMARTi SM00097. WNT1. 1 hit.
    [Graphical view ]
    PROSITEi PS00246. WNT1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Oncogenic homeodomain transcription factor E2A-Pbx1 activates a novel WNT gene in pre-B acute lymphoblastoid leukemia."
      McWhirter J.R., Neuteboom S.T., Wancewicz E.V., Monia B.P., Downing J.R., Murre C.
      Proc. Natl. Acad. Sci. U.S.A. 96:11464-11469(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16B).
    2. "Wnt-16a, a novel Wnt-16 isoform, which shows differential expression in adult human tissues."
      Fear M.W., Kelsell D.P., Spurr N.K., Barnes M.R.
      Biochem. Biophys. Res. Commun. 278:814-820(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16A), VARIANTS ARG-82 AND ILE-263.
      Tissue: Placenta.
    3. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM WNT-16B).
    5. Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-126.

    Entry informationi

    Entry nameiWNT16_HUMAN
    AccessioniPrimary (citable) accession number: Q9UBV4
    Secondary accession number(s): Q2M3G1, Q9Y5C0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 117 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3