Q9UBV4 (WNT16_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein Wnt-16 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 365 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters By similarity. |
| Subcellular location | |
| Tissue specificity | Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas. |
| Sequence similarities | Belongs to the Wnt family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Wnt-16b (identifier: Q9UBV4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Wnt-16a (identifier: Q9UBV4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-32: MDRAALLGLARLCALWAALLVLFPYGAQGNWM → MERHPPMQLTTCLRETLFTGASQKTSLW |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Potential | ||||||
| Chain | 30 – 365 | 336 | Protein Wnt-16 | PRO_0000041471 | |||||
Amino acid modifications | |||||||||
| Glycosylation | 143 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 189 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 311 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 32 | 32 | MDRAA…QGNWM → MERHPPMQLTTCLRETLFTG ASQKTSLW in isoform Wnt-16a. | VSP_006797 | |||||
| Natural variant | 82 | 1 | G → R. Ref.2 Corresponds to variant rs2908004 [ dbSNP | Ensembl ]. | VAR_052957 | |||||
| Natural variant | 126 | 1 | V → M in a colorectal cancer sample; somatic mutation. Ref.5 | VAR_036289 | |||||
| Natural variant | 263 | 1 | T → I. Ref.2 Corresponds to variant rs2707466 [ dbSNP | Ensembl ]. | VAR_052958 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF169963 mRNA. Translation: AAD49351.1. AF152584 mRNA. Translation: AAD38052.1. AC006364 Genomic DNA. No translation available. BC104919 mRNA. Translation: AAI04920.1. BC104945 mRNA. Translation: AAI04946.1. |
| IPI | IPI00002791. IPI00216310. |
| RefSeq | NP_057171.2. NM_016087.2. NP_476509.1. NM_057168.1. |
| UniGene | Hs.272375. |
3D structure databases | |
| ProteinModelPortal | Q9UBV4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UBV4. 1 interaction. |
| STRING | Q9UBV4. |
PTM databases | |
| PhosphoSite | Q9UBV4. |
Polymorphism databases | |
| DMDM | 12643875. |
Proteomic databases | |
| PRIDE | Q9UBV4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000222462; ENSP00000222462; ENSG00000002745. |
| GeneID | 51384. |
| KEGG | hsa:51384. |
| UCSC | uc003vjv.1. human. uc003vjw.1. human. |
Organism-specific databases | |
| CTD | 51384. |
| GeneCards | GC07P120965. |
| H-InvDB | HIX0033541. |
| HGNC | HGNC:16267. WNT16. |
| HPA | HPA027030. |
| MIM | 606267. gene. |
| neXtProt | NX_Q9UBV4. |
| PharmGKB | PA38105. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00560000076960. |
| HOGENOM | HBG446188. |
| HOVERGEN | HBG001595. |
| InParanoid | Q9UBV4. |
| OMA | MSSFEKI. |
| PhylomeDB | Q9UBV4. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q9UBV4. |
| Bgee | Q9UBV4. |
| CleanEx | HS_WNT16. |
| Genevestigator | Q9UBV4. |
| GermOnline | ENSG00000002745. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR005817. Wnt. IPR013304. Wnt16. IPR018161. Wnt_grthfactor_CS. [Graphical view] |
| KO | K01558. |
| PANTHER | PTHR12027. Wnt. 1 hit. |
| Pfam | PF00110. wnt. 1 hit. [Graphical view] |
| PRINTS | PR01895. WNT16PROTEIN. PR01349. WNTPROTEIN. |
| SMART | SM00097. WNT1. 1 hit. [Graphical view] |
| PROSITE | PS00246. WNT1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 54895. |
| SOURCE | Search... |
Entry information
| Entry name | WNT16_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UBV4 Secondary accession number(s): Q2M3G1, Q9Y5C0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with