Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein Wnt-16

Gene

WNT16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • bone remodeling Source: Ensembl
  • cardiac epithelial to mesenchymal transition Source: Ensembl
  • cell fate commitment Source: GO_Central
  • keratinocyte differentiation Source: BHF-UCL
  • keratinocyte proliferation Source: BHF-UCL
  • negative regulation of cell death Source: BHF-UCL
  • neuron differentiation Source: GO_Central
  • optic cup formation involved in camera-type eye development Source: BHF-UCL
  • oxidative stress-induced premature senescence Source: BHF-UCL
  • positive regulation of gene expression Source: BHF-UCL
  • positive regulation of JNK cascade Source: BHF-UCL
  • positive regulation of phosphatidylinositol 3-kinase signaling Source: BHF-UCL
  • replicative senescence Source: BHF-UCL
  • Wnt signaling pathway Source: GO_Central
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Wnt signaling pathway

Enzyme and pathway databases

ReactomeiREACT_163710. WNT ligand biogenesis and trafficking.
REACT_18372. Class B/2 (Secretin family receptors).
SignaLinkiQ9UBV4.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Wnt-16
Gene namesi
Name:WNT16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:16267. WNT16.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: BHF-UCL
  • extracellular region Source: Reactome
  • extracellular space Source: BHF-UCL
  • proteinaceous extracellular matrix Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38105.

Polymorphism and mutation databases

BioMutaiWNT16.
DMDMi12643875.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Chaini30 – 365336Protein Wnt-16PRO_0000041471Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi81 ↔ 92By similarity
Disulfide bondi139 ↔ 147By similarity
Glycosylationi143 – 1431N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi149 ↔ 168By similarity
Glycosylationi189 – 1891N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi221 ↔ 235By similarity
Disulfide bondi223 ↔ 230By similarity
Lipidationi227 – 2271O-palmitoleyl serine; by PORCNBy similarity
Disulfide bondi310 ↔ 325By similarity
Glycosylationi311 – 3111N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi340 ↔ 355By similarity
Disulfide bondi342 ↔ 352By similarity
Disulfide bondi347 ↔ 348By similarity

Post-translational modificationi

Palmitoleylation is required for efficient binding to frizzled receptors. Depalmitoleylation leads to Wnt signaling pathway inhibition.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein

Proteomic databases

PaxDbiQ9UBV4.
PRIDEiQ9UBV4.

PTM databases

PhosphoSiteiQ9UBV4.

Expressioni

Tissue specificityi

Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.

Gene expression databases

BgeeiQ9UBV4.
CleanExiHS_WNT16.
ExpressionAtlasiQ9UBV4. baseline and differential.
GenevisibleiQ9UBV4. HS.

Organism-specific databases

HPAiHPA027030.

Interactioni

Protein-protein interaction databases

BioGridi119514. 1 interaction.
IntActiQ9UBV4. 1 interaction.
STRINGi9606.ENSP00000222462.

Structurei

3D structure databases

ProteinModelPortaliQ9UBV4.
SMRiQ9UBV4. Positions 72-294.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the Wnt family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG238376.
GeneTreeiENSGT00760000118943.
HOGENOMiHOG000039529.
HOVERGENiHBG001595.
InParanoidiQ9UBV4.
KOiK01558.
OMAiTCWKTMS.
OrthoDBiEOG7C8GJ8.
PhylomeDBiQ9UBV4.
TreeFamiTF105310.

Family and domain databases

InterProiIPR005817. Wnt.
IPR013304. Wnt16.
IPR018161. Wnt_CS.
[Graphical view]
PANTHERiPTHR12027. PTHR12027. 1 hit.
PfamiPF00110. wnt. 1 hit.
[Graphical view]
PRINTSiPR01895. WNT16PROTEIN.
PR01349. WNTPROTEIN.
SMARTiSM00097. WNT1. 1 hit.
[Graphical view]
PROSITEiPS00246. WNT1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Wnt-16b (identifier: Q9UBV4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRAALLGLA RLCALWAALL VLFPYGAQGN WMWLGIASFG VPEKLGCANL
60 70 80 90 100
PLNSRQKELC KRKPYLLPSI REGARLGIQE CGSQFRHERW NCMITAAATT
110 120 130 140 150
APMGASPLFG YELSSGTKET AFIYAVMAAG LVHSVTRSCS AGNMTECSCD
160 170 180 190 200
TTLQNGGSAS EGWHWGGCSD DVQYGMWFSR KFLDFPIGNT TGKENKVLLA
210 220 230 240 250
MNLHNNEAGR QAVAKLMSVD CRCHGVSGSC AVKTCWKTMS SFEKIGHLLK
260 270 280 290 300
DKYENSIQIS DKTKRKMRRR EKDQRKIPIH KDDLLYVNKS PNYCVEDKKL
310 320 330 340 350
GIPGTQGREC NRTSEGADGC NLLCCGRGYN THVVRHVERC ECKFIWCCYV
360
RCRRCESMTD VHTCK
Length:365
Mass (Da):40,690
Last modified:May 1, 2000 - v1
Checksum:i313A26D8FFBCC56F
GO
Isoform Wnt-16a (identifier: Q9UBV4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MDRAALLGLARLCALWAALLVLFPYGAQGNWM → MERHPPMQLTTCLRETLFTGASQKTSLW

Show »
Length:361
Mass (Da):40,447
Checksum:i9C823B8C92850BBF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti82 – 821G → R.1 Publication
Corresponds to variant rs2908004 [ dbSNP | Ensembl ].
VAR_052957
Natural varianti126 – 1261V → M in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036289
Natural varianti263 – 2631T → I.1 Publication
Corresponds to variant rs2707466 [ dbSNP | Ensembl ].
VAR_052958

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MDRAA…QGNWM → MERHPPMQLTTCLRETLFTG ASQKTSLW in isoform Wnt-16a. 1 PublicationVSP_006797Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF169963 mRNA. Translation: AAD49351.1.
AF152584 mRNA. Translation: AAD38052.1.
AC006364 Genomic DNA. No translation available.
BC104919 mRNA. Translation: AAI04920.1.
BC104945 mRNA. Translation: AAI04946.1.
CCDSiCCDS5781.1. [Q9UBV4-1]
RefSeqiNP_057171.2. NM_016087.2.
NP_476509.1. NM_057168.1. [Q9UBV4-1]
UniGeneiHs.272375.

Genome annotation databases

EnsembliENST00000222462; ENSP00000222462; ENSG00000002745. [Q9UBV4-1]
GeneIDi51384.
KEGGihsa:51384.
UCSCiuc003vjw.3. human. [Q9UBV4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF169963 mRNA. Translation: AAD49351.1.
AF152584 mRNA. Translation: AAD38052.1.
AC006364 Genomic DNA. No translation available.
BC104919 mRNA. Translation: AAI04920.1.
BC104945 mRNA. Translation: AAI04946.1.
CCDSiCCDS5781.1. [Q9UBV4-1]
RefSeqiNP_057171.2. NM_016087.2.
NP_476509.1. NM_057168.1. [Q9UBV4-1]
UniGeneiHs.272375.

3D structure databases

ProteinModelPortaliQ9UBV4.
SMRiQ9UBV4. Positions 72-294.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119514. 1 interaction.
IntActiQ9UBV4. 1 interaction.
STRINGi9606.ENSP00000222462.

PTM databases

PhosphoSiteiQ9UBV4.

Polymorphism and mutation databases

BioMutaiWNT16.
DMDMi12643875.

Proteomic databases

PaxDbiQ9UBV4.
PRIDEiQ9UBV4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222462; ENSP00000222462; ENSG00000002745. [Q9UBV4-1]
GeneIDi51384.
KEGGihsa:51384.
UCSCiuc003vjw.3. human. [Q9UBV4-1]

Organism-specific databases

CTDi51384.
GeneCardsiGC07P120965.
HGNCiHGNC:16267. WNT16.
HPAiHPA027030.
MIMi606267. gene.
neXtProtiNX_Q9UBV4.
PharmGKBiPA38105.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG238376.
GeneTreeiENSGT00760000118943.
HOGENOMiHOG000039529.
HOVERGENiHBG001595.
InParanoidiQ9UBV4.
KOiK01558.
OMAiTCWKTMS.
OrthoDBiEOG7C8GJ8.
PhylomeDBiQ9UBV4.
TreeFamiTF105310.

Enzyme and pathway databases

ReactomeiREACT_163710. WNT ligand biogenesis and trafficking.
REACT_18372. Class B/2 (Secretin family receptors).
SignaLinkiQ9UBV4.

Miscellaneous databases

GeneWikiiWNT16.
GenomeRNAii51384.
NextBioi54895.
PROiQ9UBV4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UBV4.
CleanExiHS_WNT16.
ExpressionAtlasiQ9UBV4. baseline and differential.
GenevisibleiQ9UBV4. HS.

Family and domain databases

InterProiIPR005817. Wnt.
IPR013304. Wnt16.
IPR018161. Wnt_CS.
[Graphical view]
PANTHERiPTHR12027. PTHR12027. 1 hit.
PfamiPF00110. wnt. 1 hit.
[Graphical view]
PRINTSiPR01895. WNT16PROTEIN.
PR01349. WNTPROTEIN.
SMARTiSM00097. WNT1. 1 hit.
[Graphical view]
PROSITEiPS00246. WNT1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Oncogenic homeodomain transcription factor E2A-Pbx1 activates a novel WNT gene in pre-B acute lymphoblastoid leukemia."
    McWhirter J.R., Neuteboom S.T., Wancewicz E.V., Monia B.P., Downing J.R., Murre C.
    Proc. Natl. Acad. Sci. U.S.A. 96:11464-11469(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16B).
  2. "Wnt-16a, a novel Wnt-16 isoform, which shows differential expression in adult human tissues."
    Fear M.W., Kelsell D.P., Spurr N.K., Barnes M.R.
    Biochem. Biophys. Res. Commun. 278:814-820(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16A), VARIANTS ARG-82 AND ILE-263.
    Tissue: Placenta.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM WNT-16B).
  5. Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-126.

Entry informationi

Entry nameiWNT16_HUMAN
AccessioniPrimary (citable) accession number: Q9UBV4
Secondary accession number(s): Q2M3G1, Q9Y5C0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: June 24, 2015
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.