Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9UBV4 (WNT16_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 115. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein Wnt-16
Gene names
Name:WNT16
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length365 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters By similarity.

Subcellular location

Secretedextracellular spaceextracellular matrix.

Tissue specificity

Isoform Wnt-16b is expressed in peripheral lymphoid organs such as spleen, appendix, and lymph nodes, in kidney but not in bone marrow. Isoform Wnt-16a is expressed at significant levels only in the pancreas.

Post-translational modification

Palmitoylation at Ser-227 is required for efficient binding to frizzled receptors. It is also required for subsequent palmitoylation at Cys-81. Palmitoylation is necessary for proper trafficking to cell surface By similarity.

Sequence similarities

Belongs to the Wnt family.

Ontologies

Keywords
   Biological processWnt signaling pathway
   Cellular componentExtracellular matrix
Secreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   Molecular functionDevelopmental protein
   PTMGlycoprotein
Lipoprotein
Palmitate
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processWnt signaling pathway

Inferred from Biological aspect of Ancestor. Source: RefGenome

cardiac epithelial to mesenchymal transition

Inferred from electronic annotation. Source: Ensembl

cell fate commitment

Inferred from Biological aspect of Ancestor. Source: RefGenome

keratinocyte differentiation

Inferred from mutant phenotype PubMed 17200136. Source: BHF-UCL

keratinocyte proliferation

Inferred from mutant phenotype PubMed 17200136. Source: BHF-UCL

negative regulation of cell death

Inferred from mutant phenotype PubMed 17200136. Source: BHF-UCL

neuron differentiation

Inferred from Biological aspect of Ancestor. Source: RefGenome

optic cup formation involved in camera-type eye development

Inferred from sequence or structural similarity PubMed 16258938. Source: BHF-UCL

oxidative stress-induced premature senescence

Inferred from mutant phenotype PubMed 19951988. Source: BHF-UCL

positive regulation of JNK cascade

Inferred from mutant phenotype PubMed 17200136. Source: BHF-UCL

positive regulation of gene expression

Inferred from mutant phenotype PubMed 16007226. Source: BHF-UCL

positive regulation of phosphatidylinositol 3-kinase signaling

Inferred from mutant phenotype PubMed 19951988. Source: BHF-UCL

replicative senescence

Inferred from mutant phenotype PubMed 19951988. Source: BHF-UCL

   Cellular_componentcytoplasm

Inferred from direct assay PubMed 17200136. Source: BHF-UCL

extracellular region

Traceable author statement. Source: Reactome

extracellular space

Inferred from direct assay Ref.1. Source: BHF-UCL

proteinaceous extracellular matrix

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionfrizzled binding

Inferred from Biological aspect of Ancestor. Source: RefGenome

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Wnt-16b (identifier: Q9UBV4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Wnt-16a (identifier: Q9UBV4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MDRAALLGLARLCALWAALLVLFPYGAQGNWM → MERHPPMQLTTCLRETLFTGASQKTSLW

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Chain30 – 365336Protein Wnt-16
PRO_0000041471

Amino acid modifications

Lipidation811S-palmitoyl cysteine By similarity
Lipidation2271O-palmitoyl serine; by PORCN By similarity
Glycosylation1431N-linked (GlcNAc...) Potential
Glycosylation1891N-linked (GlcNAc...) Potential
Glycosylation3111N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 3232MDRAA…QGNWM → MERHPPMQLTTCLRETLFTG ASQKTSLW in isoform Wnt-16a.
VSP_006797
Natural variant821G → R. Ref.2
Corresponds to variant rs2908004 [ dbSNP | Ensembl ].
VAR_052957
Natural variant1261V → M in a colorectal cancer sample; somatic mutation. Ref.5
VAR_036289
Natural variant2631T → I. Ref.2
Corresponds to variant rs2707466 [ dbSNP | Ensembl ].
VAR_052958

Sequences

Sequence LengthMass (Da)Tools
Isoform Wnt-16b [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 313A26D8FFBCC56F

FASTA36540,690
        10         20         30         40         50         60 
MDRAALLGLA RLCALWAALL VLFPYGAQGN WMWLGIASFG VPEKLGCANL PLNSRQKELC 

        70         80         90        100        110        120 
KRKPYLLPSI REGARLGIQE CGSQFRHERW NCMITAAATT APMGASPLFG YELSSGTKET 

       130        140        150        160        170        180 
AFIYAVMAAG LVHSVTRSCS AGNMTECSCD TTLQNGGSAS EGWHWGGCSD DVQYGMWFSR 

       190        200        210        220        230        240 
KFLDFPIGNT TGKENKVLLA MNLHNNEAGR QAVAKLMSVD CRCHGVSGSC AVKTCWKTMS 

       250        260        270        280        290        300 
SFEKIGHLLK DKYENSIQIS DKTKRKMRRR EKDQRKIPIH KDDLLYVNKS PNYCVEDKKL 

       310        320        330        340        350        360 
GIPGTQGREC NRTSEGADGC NLLCCGRGYN THVVRHVERC ECKFIWCCYV RCRRCESMTD 


VHTCK 

« Hide

Isoform Wnt-16a [UniParc].

Checksum: 9C823B8C92850BBF
Show »

FASTA36140,447

References

« Hide 'large scale' references
[1]"Oncogenic homeodomain transcription factor E2A-Pbx1 activates a novel WNT gene in pre-B acute lymphoblastoid leukemia."
McWhirter J.R., Neuteboom S.T., Wancewicz E.V., Monia B.P., Downing J.R., Murre C.
Proc. Natl. Acad. Sci. U.S.A. 96:11464-11469(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16B).
[2]"Wnt-16a, a novel Wnt-16 isoform, which shows differential expression in adult human tissues."
Fear M.W., Kelsell D.P., Spurr N.K., Barnes M.R.
Biochem. Biophys. Res. Commun. 278:814-820(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM WNT-16A), VARIANTS ARG-82 AND ILE-263.
Tissue: Placenta.
[3]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM WNT-16B).
[5]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] MET-126.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF169963 mRNA. Translation: AAD49351.1.
AF152584 mRNA. Translation: AAD38052.1.
AC006364 Genomic DNA. No translation available.
BC104919 mRNA. Translation: AAI04920.1.
BC104945 mRNA. Translation: AAI04946.1.
CCDSCCDS5781.1. [Q9UBV4-1]
RefSeqNP_057171.2. NM_016087.2.
NP_476509.1. NM_057168.1. [Q9UBV4-1]
UniGeneHs.272375.

3D structure databases

ProteinModelPortalQ9UBV4.
SMRQ9UBV4. Positions 72-294.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119514. 1 interaction.
IntActQ9UBV4. 1 interaction.
STRING9606.ENSP00000222462.

PTM databases

PhosphoSiteQ9UBV4.

Polymorphism databases

DMDM12643875.

Proteomic databases

PaxDbQ9UBV4.
PRIDEQ9UBV4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000222462; ENSP00000222462; ENSG00000002745. [Q9UBV4-1]
GeneID51384.
KEGGhsa:51384.
UCSCuc003vjw.3. human. [Q9UBV4-1]

Organism-specific databases

CTD51384.
GeneCardsGC07P120965.
HGNCHGNC:16267. WNT16.
HPAHPA027030.
MIM606267. gene.
neXtProtNX_Q9UBV4.
PharmGKBPA38105.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG238376.
HOGENOMHOG000039529.
HOVERGENHBG001595.
InParanoidQ9UBV4.
KOK01558.
OMACWKTMSS.
OrthoDBEOG7C8GJ8.
PhylomeDBQ9UBV4.
TreeFamTF105310.

Enzyme and pathway databases

ReactomeREACT_111102. Signal Transduction.
SignaLinkQ9UBV4.

Gene expression databases

ArrayExpressQ9UBV4.
BgeeQ9UBV4.
CleanExHS_WNT16.
GenevestigatorQ9UBV4.

Family and domain databases

InterProIPR005817. Wnt.
IPR013304. Wnt16.
IPR018161. Wnt_CS.
[Graphical view]
PANTHERPTHR12027. PTHR12027. 1 hit.
PfamPF00110. wnt. 1 hit.
[Graphical view]
PRINTSPR01895. WNT16PROTEIN.
PR01349. WNTPROTEIN.
SMARTSM00097. WNT1. 1 hit.
[Graphical view]
PROSITEPS00246. WNT1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiWNT16.
GenomeRNAi51384.
NextBio54895.
PROQ9UBV4.
SOURCESearch...

Entry information

Entry nameWNT16_HUMAN
AccessionPrimary (citable) accession number: Q9UBV4
Secondary accession number(s): Q2M3G1, Q9Y5C0
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM