Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Appetite-regulating hormone

Gene

GHRL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.
Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility (By similarity).By similarity

GO - Molecular functioni

  • ghrelin receptor binding Source: UniProtKB
  • G-protein coupled receptor binding Source: UniProtKB
  • growth hormone-releasing hormone activity Source: UniProtKB
  • protein tyrosine kinase activator activity Source: UniProtKB

GO - Biological processi

  • actin polymerization or depolymerization Source: UniProtKB
  • activation of MAPK activity Source: UniProtKB
  • adult feeding behavior Source: HGNC
  • cartilage development Source: UniProtKB
  • cortisol secretion Source: UniProtKB
  • decidualization Source: UniProtKB
  • dendrite development Source: MGI
  • excitatory postsynaptic potential Source: Ensembl
  • gastric acid secretion Source: GO_Central
  • glucose metabolic process Source: UniProtKB
  • G-protein coupled receptor signaling pathway Source: UniProtKB
  • growth hormone secretion Source: HGNC
  • hormone-mediated signaling pathway Source: HGNC
  • negative regulation of angiogenesis Source: UniProtKB
  • negative regulation of apoptotic process Source: UniProtKB
  • negative regulation of circadian sleep/wake cycle, REM sleep Source: BHF-UCL
  • negative regulation of endothelial cell proliferation Source: UniProtKB
  • negative regulation of energy homeostasis Source: Ensembl
  • negative regulation of inflammatory response Source: UniProtKB
  • negative regulation of insulin secretion Source: Ensembl
  • negative regulation of interleukin-1 beta production Source: UniProtKB
  • negative regulation of interleukin-6 biosynthetic process Source: UniProtKB
  • negative regulation of locomotion Source: Ensembl
  • negative regulation of tumor necrosis factor biosynthetic process Source: UniProtKB
  • positive regulation of appetite Source: HGNC
  • positive regulation of circadian sleep/wake cycle, non-REM sleep Source: BHF-UCL
  • positive regulation of corticotropin secretion Source: BHF-UCL
  • positive regulation of cortisol secretion Source: BHF-UCL
  • positive regulation of cytosolic calcium ion concentration Source: UniProtKB
  • positive regulation of energy homeostasis Source: Ensembl
  • positive regulation of growth hormone receptor signaling pathway Source: BHF-UCL
  • positive regulation of growth hormone secretion Source: BHF-UCL
  • positive regulation of insulin secretion Source: UniProtKB
  • positive regulation of multicellular organism growth Source: HGNC
  • positive regulation of synapse assembly Source: MGI
  • regulation of cell proliferation Source: UniProtKB
  • regulation of response to food Source: GO_Central
  • response to estrogen Source: UniProtKB
  • response to hormone Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hormone

Enzyme and pathway databases

BioCyciZFISH:ENSG00000157017-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-422085. Synthesis, secretion, and deacylation of Ghrelin.
SIGNORiQ9UBU3.

Names & Taxonomyi

Protein namesi
Recommended name:
Appetite-regulating hormone
Alternative name(s):
Growth hormone secretagogue
Growth hormone-releasing peptide
Motilin-related peptide
Protein M46
Cleaved into the following 3 chains:
Gene namesi
Name:GHRL
Synonyms:MTLRP
ORF Names:UNQ524/PRO1066
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:18129. GHRL.

Subcellular locationi

GO - Cellular componenti

  • axon Source: UniProtKB
  • endoplasmic reticulum lumen Source: Reactome
  • extracellular region Source: UniProtKB
  • extracellular space Source: UniProtKB
  • postsynapse Source: GOC
  • secretory granule lumen Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi51738.
MalaCardsiGHRL.
OpenTargetsiENSG00000157017.
PharmGKBiPA142671740.

Chemistry databases

ChEMBLiCHEMBL1921664.

Polymorphism and mutation databases

BioMutaiGHRL.
DMDMi17865471.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 232 PublicationsAdd BLAST23
PeptideiPRO_000001920224 – 51Ghrelin-28Add BLAST28
PeptideiPRO_000001920324 – 50Ghrelin-27Add BLAST27
PropeptideiPRO_000001920452 – 75Removed in mature formAdd BLAST24
PeptideiPRO_000004514076 – 98ObestatinBy similarityAdd BLAST23
PropeptideiPRO_000004514199 – 117Removed in mature formBy similarityAdd BLAST19

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi26O-decanoyl serine; alternate2 Publications1
Lipidationi26O-octanoyl serine; alternate2 Publications1
Modified residuei98Leucine amideBy similarity1

Post-translational modificationi

O-octanoylation or O-decanoylation is essential for ghrelin activity. The O-decanoylated forms Ghrelin-27-C10 and Ghrelin-28-C10 differ in the length of the carbon backbone of the carboxylic acid bound to Ser-26. A small fraction of ghrelin, ghrelin-28-C10:1, may be modified with a singly unsaturated carboxylic acid (PubMed:10604470).1 Publication
Amidation of Leu-98 is essential for obestatin activity.By similarity

Keywords - PTMi

Amidation, Lipoprotein

Proteomic databases

PaxDbiQ9UBU3.
PeptideAtlasiQ9UBU3.
PRIDEiQ9UBU3.

PTM databases

iPTMnetiQ9UBU3.
PhosphoSitePlusiQ9UBU3.

Miscellaneous databases

PMAP-CutDBQ9UBU3.

Expressioni

Tissue specificityi

Highest level in stomach. All forms are found in serum as well. Other tissues compensate for the loss of ghrelin synthesis in the stomach following gastrectomy.1 Publication

Gene expression databases

BgeeiENSG00000157017.
CleanExiHS_GHRL.
ExpressionAtlasiQ9UBU3. baseline and differential.
GenevisibleiQ9UBU3. HS.

Organism-specific databases

HPAiCAB022731.
HPA014246.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
UBQLN1Q9UMX03EBI-10319458,EBI-741480
UBQLN1Q9UMX0-23EBI-10319458,EBI-10173939

GO - Molecular functioni

  • ghrelin receptor binding Source: UniProtKB
  • G-protein coupled receptor binding Source: UniProtKB
  • growth hormone-releasing hormone activity Source: UniProtKB

Protein-protein interaction databases

BioGridi119706. 5 interactors.
IntActiQ9UBU3. 2 interactors.
STRINGi9606.ENSP00000335074.

Chemistry databases

BindingDBiQ9UBU3.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P7Xmodel-A1-117[»]
ProteinModelPortaliQ9UBU3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the motilin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IZYV. Eukaryota.
ENOG410ZG1B. LUCA.
GeneTreeiENSGT00390000004064.
HOGENOMiHOG000146466.
HOVERGENiHBG018522.
InParanoidiQ9UBU3.
KOiK05254.
OMAiEIQFNAP.
OrthoDBiEOG091G0YG0.
PhylomeDBiQ9UBU3.
TreeFamiTF336219.

Family and domain databases

InterProiIPR006737. Motilin_assoc.
IPR006738. Motilin_ghrelin.
IPR005441. Preproghrelin.
[Graphical view]
PANTHERiPTHR14122. PTHR14122. 1 hit.
PfamiPF04643. Motilin_assoc. 1 hit.
PF04644. Motilin_ghrelin. 1 hit.
[Graphical view]
PRINTSiPR01624. GHRELIN.

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBU3-1) [UniParc]FASTAAdd to basket
Also known as: Ghrelin

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPSPGTVCSL LLLGMLWLDL AMAGSSFLSP EHQRVQQRKE SKKPPAKLQP
60 70 80 90 100
RALAGWLRPE DGGQAEGAED ELEVRFNAPF DVGIKLSGVQ YQQHSQALGK
110
FLQDILWEEA KEAPADK
Length:117
Mass (Da):12,911
Last modified:May 1, 2000 - v1
Checksum:i39C0572EBECA2755
GO
Isoform 2 (identifier: Q9UBU3-2) [UniParc]FASTAAdd to basket
Also known as: des-Gln14-ghrelin

The sequence of this isoform differs from the canonical sequence as follows:
     37-37: Missing.

Show »
Length:116
Mass (Da):12,783
Checksum:iF0DEBEEE880DC951
GO
Isoform 3 (identifier: Q9UBU3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQ → MFTCWWSYLRSTLAAVPGEASRVQ

Show »
Length:105
Mass (Da):11,784
Checksum:i9E4000D6A0863F99
GO
Isoform 4 (identifier: Q9UBU3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQ → MFTCWWSYLRSTLAAVPGEASRVQ
     37-37: Missing.

Show »
Length:104
Mass (Da):11,656
Checksum:i508946F0C415058F
GO
Isoform 5 (identifier: Q9UBU3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-75: MPSPGTVCSL...EGAEDELEVR → MFTCWWSYLRSTLAAVPGEASRVQ

Show »
Length:66
Mass (Da):7,460
Checksum:i5001F0A57716C83D
GO
Isoform 6 (identifier: Q9UBU3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     76-117: FNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK → RPQPTSDRPQALLTSL

Show »
Length:91
Mass (Da):9,972
Checksum:iE7E532D32A3F8609
GO

Mass spectrometryi

Molecular mass is 3398.9±0.3 Da from positions 24 - 51. Determined by ESI. Ghrelin-28-C10, O-decanoylated form.1 Publication
Molecular mass is 3397.2±0.5 Da from positions 24 - 51. Determined by ESI. Ghrelin-28-C10:1, O-decenoylated form.1 Publication
Molecular mass is 3371.3±0.1 Da from positions 24 - 51. Determined by ESI. Ghrelin-28-C8, O-octanoylated form.1 Publication
Molecular mass is 3243.6±0.4 Da from positions 24 - 50. Determined by ESI. Ghrelin-27-C10, O-decanoylated form.1 Publication
Molecular mass is 3214.6±0.6 Da from positions 24 - 50. Determined by ESI. Ghrelin-27-C8, O-octanoylated form.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05009572L → M.1 PublicationCorresponds to variant rs696217dbSNPEnsembl.1
Natural variantiVAR_02913590Q → L.Corresponds to variant rs4684677dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0414381 – 75MPSPG…ELEVR → MFTCWWSYLRSTLAAVPGEA SRVQ in isoform 5. 1 PublicationAdd BLAST75
Alternative sequenceiVSP_0414371 – 36MPSPG…HQRVQ → MFTCWWSYLRSTLAAVPGEA SRVQ in isoform 3 and isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_00324537Missing in isoform 2 and isoform 4. 2 Publications1
Alternative sequenceiVSP_04764276 – 117FNAPF…APADK → RPQPTSDRPQALLTSL in isoform 6. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB029434 mRNA. Translation: BAA89371.1.
AJ252278 mRNA. Translation: CAB65733.1.
AF296558 Genomic DNA. Translation: AAG10300.1.
EU072086 mRNA. Translation: ABV55189.1.
EF549569 mRNA. Translation: ABQ40357.1.
EF549571 mRNA. Translation: ABQ40358.1.
EF549572 mRNA. Translation: ABQ40359.1.
EF549573 mRNA. Translation: ABQ40360.1.
EF549574 mRNA. Translation: ABQ40361.1.
EF549575 mRNA. Translation: ABQ40362.1.
EU072083 mRNA. Translation: ABV55186.1.
EU072084 mRNA. Translation: ABV55187.1.
EU072085 mRNA. Translation: ABV55188.1.
EU072087 mRNA. Translation: ABV55190.1.
AY184207 mRNA. Translation: AAO27351.1.
AY359053 mRNA. Translation: AAQ89412.1.
AC022384 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64074.1.
CH471055 Genomic DNA. Translation: EAW64075.1.
BC025791 mRNA. Translation: AAH25791.1.
AB035700 mRNA. Translation: BAB19045.1.
CCDSiCCDS33700.1. [Q9UBU3-1]
CCDS46747.1. [Q9UBU3-5]
CCDS46748.1. [Q9UBU3-3]
CCDS46749.1. [Q9UBU3-4]
CCDS46750.1. [Q9UBU3-2]
PIRiA59316.
RefSeqiNP_001128413.1. NM_001134941.2. [Q9UBU3-2]
NP_001128416.1. NM_001134944.1. [Q9UBU3-3]
NP_001128417.1. NM_001134945.1. [Q9UBU3-4]
NP_001128418.1. NM_001134946.1. [Q9UBU3-5]
NP_001289750.1. NM_001302821.1. [Q9UBU3-1]
NP_001289751.1. NM_001302822.1. [Q9UBU3-1]
NP_001289752.1. NM_001302823.1. [Q9UBU3-2]
NP_001289753.1. NM_001302824.1. [Q9UBU3-1]
NP_001289754.1. NM_001302825.1. [Q9UBU3-1]
NP_057446.1. NM_016362.4. [Q9UBU3-1]
XP_016862101.1. XM_017006612.1. [Q9UBU3-1]
XP_016862102.1. XM_017006613.1. [Q9UBU3-2]
UniGeneiHs.590080.
Hs.672979.

Genome annotation databases

EnsembliENST00000287656; ENSP00000287656; ENSG00000157017. [Q9UBU3-2]
ENST00000335542; ENSP00000335074; ENSG00000157017. [Q9UBU3-1]
ENST00000422159; ENSP00000405464; ENSG00000157017. [Q9UBU3-6]
ENST00000429122; ENSP00000414819; ENSG00000157017. [Q9UBU3-1]
ENST00000430179; ENSP00000399922; ENSG00000157017. [Q9UBU3-2]
ENST00000437422; ENSP00000416768; ENSG00000157017. [Q9UBU3-3]
ENST00000439975; ENSP00000403725; ENSG00000157017. [Q9UBU3-5]
ENST00000449238; ENSP00000388145; ENSG00000157017. [Q9UBU3-4]
ENST00000457360; ENSP00000391406; ENSG00000157017. [Q9UBU3-1]
GeneIDi51738.
KEGGihsa:51738.
UCSCiuc003bvj.2. human. [Q9UBU3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology
Protein Spotlight

Gut feelings - Issue 66 of January 2006

Wikipedia

Ghrelin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB029434 mRNA. Translation: BAA89371.1.
AJ252278 mRNA. Translation: CAB65733.1.
AF296558 Genomic DNA. Translation: AAG10300.1.
EU072086 mRNA. Translation: ABV55189.1.
EF549569 mRNA. Translation: ABQ40357.1.
EF549571 mRNA. Translation: ABQ40358.1.
EF549572 mRNA. Translation: ABQ40359.1.
EF549573 mRNA. Translation: ABQ40360.1.
EF549574 mRNA. Translation: ABQ40361.1.
EF549575 mRNA. Translation: ABQ40362.1.
EU072083 mRNA. Translation: ABV55186.1.
EU072084 mRNA. Translation: ABV55187.1.
EU072085 mRNA. Translation: ABV55188.1.
EU072087 mRNA. Translation: ABV55190.1.
AY184207 mRNA. Translation: AAO27351.1.
AY359053 mRNA. Translation: AAQ89412.1.
AC022384 Genomic DNA. No translation available.
CH471055 Genomic DNA. Translation: EAW64074.1.
CH471055 Genomic DNA. Translation: EAW64075.1.
BC025791 mRNA. Translation: AAH25791.1.
AB035700 mRNA. Translation: BAB19045.1.
CCDSiCCDS33700.1. [Q9UBU3-1]
CCDS46747.1. [Q9UBU3-5]
CCDS46748.1. [Q9UBU3-3]
CCDS46749.1. [Q9UBU3-4]
CCDS46750.1. [Q9UBU3-2]
PIRiA59316.
RefSeqiNP_001128413.1. NM_001134941.2. [Q9UBU3-2]
NP_001128416.1. NM_001134944.1. [Q9UBU3-3]
NP_001128417.1. NM_001134945.1. [Q9UBU3-4]
NP_001128418.1. NM_001134946.1. [Q9UBU3-5]
NP_001289750.1. NM_001302821.1. [Q9UBU3-1]
NP_001289751.1. NM_001302822.1. [Q9UBU3-1]
NP_001289752.1. NM_001302823.1. [Q9UBU3-2]
NP_001289753.1. NM_001302824.1. [Q9UBU3-1]
NP_001289754.1. NM_001302825.1. [Q9UBU3-1]
NP_057446.1. NM_016362.4. [Q9UBU3-1]
XP_016862101.1. XM_017006612.1. [Q9UBU3-1]
XP_016862102.1. XM_017006613.1. [Q9UBU3-2]
UniGeneiHs.590080.
Hs.672979.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1P7Xmodel-A1-117[»]
ProteinModelPortaliQ9UBU3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119706. 5 interactors.
IntActiQ9UBU3. 2 interactors.
STRINGi9606.ENSP00000335074.

Chemistry databases

BindingDBiQ9UBU3.
ChEMBLiCHEMBL1921664.

PTM databases

iPTMnetiQ9UBU3.
PhosphoSitePlusiQ9UBU3.

Polymorphism and mutation databases

BioMutaiGHRL.
DMDMi17865471.

Proteomic databases

PaxDbiQ9UBU3.
PeptideAtlasiQ9UBU3.
PRIDEiQ9UBU3.

Protocols and materials databases

DNASUi51738.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287656; ENSP00000287656; ENSG00000157017. [Q9UBU3-2]
ENST00000335542; ENSP00000335074; ENSG00000157017. [Q9UBU3-1]
ENST00000422159; ENSP00000405464; ENSG00000157017. [Q9UBU3-6]
ENST00000429122; ENSP00000414819; ENSG00000157017. [Q9UBU3-1]
ENST00000430179; ENSP00000399922; ENSG00000157017. [Q9UBU3-2]
ENST00000437422; ENSP00000416768; ENSG00000157017. [Q9UBU3-3]
ENST00000439975; ENSP00000403725; ENSG00000157017. [Q9UBU3-5]
ENST00000449238; ENSP00000388145; ENSG00000157017. [Q9UBU3-4]
ENST00000457360; ENSP00000391406; ENSG00000157017. [Q9UBU3-1]
GeneIDi51738.
KEGGihsa:51738.
UCSCiuc003bvj.2. human. [Q9UBU3-1]

Organism-specific databases

CTDi51738.
DisGeNETi51738.
GeneCardsiGHRL.
HGNCiHGNC:18129. GHRL.
HPAiCAB022731.
HPA014246.
MalaCardsiGHRL.
MIMi605353. gene.
neXtProtiNX_Q9UBU3.
OpenTargetsiENSG00000157017.
PharmGKBiPA142671740.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZYV. Eukaryota.
ENOG410ZG1B. LUCA.
GeneTreeiENSGT00390000004064.
HOGENOMiHOG000146466.
HOVERGENiHBG018522.
InParanoidiQ9UBU3.
KOiK05254.
OMAiEIQFNAP.
OrthoDBiEOG091G0YG0.
PhylomeDBiQ9UBU3.
TreeFamiTF336219.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000157017-MONOMER.
ReactomeiR-HSA-375276. Peptide ligand-binding receptors.
R-HSA-416476. G alpha (q) signalling events.
R-HSA-422085. Synthesis, secretion, and deacylation of Ghrelin.
SIGNORiQ9UBU3.

Miscellaneous databases

GeneWikiiGhrelin.
GenomeRNAii51738.
PMAP-CutDBQ9UBU3.
PROiQ9UBU3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000157017.
CleanExiHS_GHRL.
ExpressionAtlasiQ9UBU3. baseline and differential.
GenevisibleiQ9UBU3. HS.

Family and domain databases

InterProiIPR006737. Motilin_assoc.
IPR006738. Motilin_ghrelin.
IPR005441. Preproghrelin.
[Graphical view]
PANTHERiPTHR14122. PTHR14122. 1 hit.
PfamiPF04643. Motilin_assoc. 1 hit.
PF04644. Motilin_ghrelin. 1 hit.
[Graphical view]
PRINTSiPR01624. GHRELIN.
ProtoNetiSearch...

Entry informationi

Entry nameiGHRL_HUMAN
AccessioniPrimary (citable) accession number: Q9UBU3
Secondary accession number(s): A8CF34
, A8CF38, A8CF42, A8DN29, A8DN30, Q86YP8, Q8TAT9, Q9H3R3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 13, 2001
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 168 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.