Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA polymerase kappa

Gene

POLK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. Lacks 3'-5' proofreading exonuclease activity. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but does not have lyase activity.7 Publications

Catalytic activityi

Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

Cofactori

Mg2+1 Publication, Mn2+1 PublicationNote: Divalent metal cations. Prefers Mg2+, but can also use Mn2+.1 Publication

pH dependencei

Optimum pH is 6.5-7.5.

Temperature dependencei

Optimum temperature is 37 degrees Celsius.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi107MagnesiumBy similarity1
Metal bindingi198MagnesiumBy similarity1
Metal bindingi199MagnesiumBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri621 – 647UBZ-type 1Add BLAST27
Zinc fingeri776 – 802UBZ-type 2Add BLAST27

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

DNA-directed DNA polymerase, Mutator protein, Nucleotidyltransferase, Transferase

Keywords - Biological processi

DNA damage, DNA repair, DNA replication, DNA synthesis

Keywords - Ligandi

DNA-binding, Magnesium, Metal-binding, Schiff base, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS04538-MONOMER.
ReactomeiR-HSA-5655862. Translesion synthesis by POLK.
R-HSA-5656169. Termination of translesion DNA synthesis.
R-HSA-5685942. HDR through Homologous Recombination (HRR).
R-HSA-5696397. Gap-filling DNA repair synthesis and ligation in GG-NER.
R-HSA-5696400. Dual Incision in GG-NER.
R-HSA-6782135. Dual incision in TC-NER.
R-HSA-6782210. Gap-filling DNA repair synthesis and ligation in TC-NER.

Names & Taxonomyi

Protein namesi
Recommended name:
DNA polymerase kappa (EC:2.7.7.7)
Alternative name(s):
DINB protein
Short name:
DINP
Gene namesi
Name:POLK
Synonyms:DINB1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:9183. POLK.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi198D → A: Loss of DNA polymerase activity; when associated with A-199. 1 Publication1
Mutagenesisi199E → A: Loss of DNA polymerase activity; when associated with D-198. 1 Publication1

Organism-specific databases

DisGeNETi51426.
OpenTargetsiENSG00000122008.
PharmGKBiPA33503.

Chemistry databases

ChEMBLiCHEMBL5365.

Polymorphism and mutation databases

BioMutaiPOLK.
DMDMi59798438.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001739901 – 870DNA polymerase kappaAdd BLAST870

Proteomic databases

EPDiQ9UBT6.
PaxDbiQ9UBT6.
PeptideAtlasiQ9UBT6.
PRIDEiQ9UBT6.

PTM databases

iPTMnetiQ9UBT6.
PhosphoSitePlusiQ9UBT6.

Expressioni

Tissue specificityi

Detected at low levels in testis, spleen, prostate and ovary. Detected at very low levels in kidney, colon, brain, heart, liver, lung, placenta, pancreas and peripheral blood leukocytes.2 Publications

Gene expression databases

BgeeiENSG00000122008.
ExpressionAtlasiQ9UBT6. baseline and differential.
GenevisibleiQ9UBT6. HS.

Organism-specific databases

HPAiHPA012035.
HPA057303.
HPA068117.

Interactioni

Subunit structurei

Interacts with REV1 (By similarity). Interacts with PCNA.By similarity1 Publication

Protein-protein interaction databases

BioGridi119532. 43 interactors.
IntActiQ9UBT6. 26 interactors.
STRINGi9606.ENSP00000241436.

Chemistry databases

BindingDBiQ9UBT6.

Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi33 – 44Combined sources12
Helixi48 – 72Combined sources25
Helixi78 – 94Combined sources17
Beta strandi103 – 108Combined sources6
Helixi111 – 119Combined sources9
Helixi121 – 123Combined sources3
Beta strandi128 – 131Combined sources4
Beta strandi136 – 139Combined sources4
Helixi141 – 145Combined sources5
Helixi154 – 160Combined sources7
Beta strandi165 – 167Combined sources3
Helixi171 – 188Combined sources18
Beta strandi196 – 203Combined sources8
Helixi205 – 211Combined sources7
Helixi216 – 218Combined sources3
Beta strandi219 – 222Combined sources4
Helixi236 – 241Combined sources6
Turni243 – 248Combined sources6
Helixi249 – 251Combined sources3
Beta strandi283 – 285Combined sources3
Helixi290 – 305Combined sources16
Beta strandi309 – 316Combined sources8
Helixi317 – 326Combined sources10
Turni327 – 330Combined sources4
Beta strandi332 – 334Combined sources3
Helixi339 – 346Combined sources8
Helixi351 – 353Combined sources3
Helixi359 – 367Combined sources9
Helixi373 – 378Combined sources6
Helixi380 – 386Combined sources7
Helixi389 – 399Combined sources11
Beta strandi416 – 425Combined sources10
Helixi428 – 439Combined sources12
Turni448 – 450Combined sources3
Beta strandi456 – 462Combined sources7
Beta strandi467 – 470Combined sources4
Helixi484 – 496Combined sources13
Beta strandi497 – 499Combined sources3
Beta strandi506 – 513Combined sources8
Helixi567 – 574Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1T94X-ray2.40A/B68-526[»]
2LSINMR-B562-577[»]
2OH2X-ray3.05A/B19-526[»]
2W7OX-ray3.16A/B19-526[»]
2W7PX-ray3.71A/B19-526[»]
3IN5X-ray3.20A/B19-526[»]
3PZPX-ray3.34A/B19-528[»]
4BA9X-ray2.73A/B/C/D/E/F563-575[»]
4GK5X-ray3.21G564-573[»]
4U6PX-ray2.59A/B1-526[»]
4U7CX-ray2.80A/B27-518[»]
ProteinModelPortaliQ9UBT6.
SMRiQ9UBT6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UBT6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 358UmuCAdd BLAST256

Domaini

The catalytic core consists of fingers, palm and thumb subdomains, but the fingers and thumb subdomains are much smaller than in high-fidelity polymerases; residues from five sequence motifs of the Y-family cluster around an active site cleft that can accommodate DNA and nucleotide substrates with relaxed geometric constraints, with consequently higher rates of misincorporation and low processivity.

Sequence similaritiesi

Belongs to the DNA polymerase type-Y family.Curated
Contains 2 UBZ-type zinc fingers.Curated
Contains 1 umuC domain.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri621 – 647UBZ-type 1Add BLAST27
Zinc fingeri776 – 802UBZ-type 2Add BLAST27

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG2094. Eukaryota.
COG0389. LUCA.
GeneTreeiENSGT00530000062942.
HOGENOMiHOG000082711.
HOVERGENiHBG101212.
InParanoidiQ9UBT6.
KOiK03511.
OMAiNWPEDKR.
OrthoDBiEOG091G0679.
PhylomeDBiQ9UBT6.
TreeFamiTF314387.

Family and domain databases

Gene3Di3.30.1490.100. 1 hit.
HAMAPiMF_01113. DNApol_IV. 1 hit.
InterProiIPR017961. DNA_pol_Y-fam_little_finger.
IPR022880. DNApol_IV.
IPR024728. PolY_HhH_motif.
IPR001126. UmuC.
IPR006642. Znf_Rad18_put.
[Graphical view]
PfamiPF00817. IMS. 1 hit.
PF11799. IMS_C. 1 hit.
PF11798. IMS_HHH. 1 hit.
[Graphical view]
SMARTiSM00734. ZnF_Rad18. 2 hits.
[Graphical view]
SUPFAMiSSF100879. SSF100879. 1 hit.
PROSITEiPS50173. UMUC. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDSTKEKCDS YKDDLLLRMG LNDNKAGMEG LDKEKINKII MEATKGSRFY
60 70 80 90 100
GNELKKEKQV NQRIENMMQQ KAQITSQQLR KAQLQVDRFA MELEQSRNLS
110 120 130 140 150
NTIVHIDMDA FYAAVEMRDN PELKDKPIAV GSMSMLSTSN YHARRFGVRA
160 170 180 190 200
AMPGFIAKRL CPQLIIVPPN FDKYRAVSKE VKEILADYDP NFMAMSLDEA
210 220 230 240 250
YLNITKHLEE RQNWPEDKRR YFIKMGSSVE NDNPGKEVNK LSEHERSISP
260 270 280 290 300
LLFEESPSDV QPPGDPFQVN FEEQNNPQIL QNSVVFGTSA QEVVKEIRFR
310 320 330 340 350
IEQKTTLTAS AGIAPNTMLA KVCSDKNKPN GQYQILPNRQ AVMDFIKDLP
360 370 380 390 400
IRKVSGIGKV TEKMLKALGI ITCTELYQQR ALLSLLFSET SWHYFLHISL
410 420 430 440 450
GLGSTHLTRD GERKSMSVER TFSEINKAEE QYSLCQELCS ELAQDLQKER
460 470 480 490 500
LKGRTVTIKL KNVNFEVKTR ASTVSSVVST AEEIFAIAKE LLKTEIDADF
510 520 530 540 550
PHPLRLRLMG VRISSFPNEE DRKHQQRSII GFLQAGNQAL SATECTLEKT
560 570 580 590 600
DKDKFVKPLE MSHKKSFFDK KRSERKWSHQ DTFKCEAVNK QSFQTSQPFQ
610 620 630 640 650
VLKKKMNENL EISENSDDCQ ILTCPVCFRA QGCISLEALN KHVDECLDGP
660 670 680 690 700
SISENFKMFS CSHVSATKVN KKENVPASSL CEKQDYEAHP KIKEISSVDC
710 720 730 740 750
IALVDTIDNS SKAESIDALS NKHSKEECSS LPSKSFNIEH CHQNSSSTVS
760 770 780 790 800
LENEDVGSFR QEYRQPYLCE VKTGQALVCP VCNVEQKTSD LTLFNVHVDV
810 820 830 840 850
CLNKSFIQEL RKDKFNPVNQ PKESSRSTGS SSGVQKAVTR TKRPGLMTKY
860 870
STSKKIKPNN PKHTLDIFFK
Length:870
Mass (Da):98,809
Last modified:May 1, 2000 - v1
Checksum:i40CB259A65F6A796
GO
Isoform 2 (identifier: Q9UBT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-472: GRTVTIKLKNVNFEVKTRAS → VLYFDMVSLVFKFFNSKMLP
     473-870: Missing.

Note: No experimental confirmation available.
Show »
Length:472
Mass (Da):54,132
Checksum:i45D26D63D90D0225
GO
Isoform 3 (identifier: Q9UBT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-509: Missing.

Show »
Length:672
Mass (Da):76,454
Checksum:iD5BADE5559C88977
GO
Isoform 4 (identifier: Q9UBT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     453-462: GRTVTIKLKN → KKYLPLLRNC
     463-870: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:372
Mass (Da):42,487
Checksum:iFFDC64B0DC9D2A35
GO
Isoform 5 (identifier: Q9UBT6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-489: GRTVTIKLKNVNFEVKTRASTVSSVVSTAEEIFAIAK → VFGYLVFPMKRTGNTNKGALLAFYRLETKPCQPLSVH
     490-870: Missing.

Show »
Length:489
Mass (Da):55,904
Checksum:iB3EA53A1890A1C9E
GO
Isoform 6 (identifier: Q9UBT6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     453-461: GRTVTIKLK → VAQVEYRRL
     462-870: Missing.

Show »
Length:461
Mass (Da):52,839
Checksum:iF2D33767C82284BD
GO
Isoform 7 (identifier: Q9UBT6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.
     453-461: GRTVTIKLK → VAQVEYRRL
     462-870: Missing.

Show »
Length:371
Mass (Da):42,372
Checksum:iB72DA3E0F14FD870
GO
Isoform 8 (identifier: Q9UBT6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-90: Missing.

Show »
Length:780
Mass (Da):88,342
Checksum:iE36919BC4E7D4C84
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti21L → F in BAB58975 (Ref. 11) Curated1
Sequence conflicti39I → T in BAB58975 (Ref. 11) Curated1
Sequence conflicti219R → L in BAB58976 (Ref. 11) Curated1
Sequence conflicti342V → G in BAC03714 (PubMed:14702039).Curated1
Sequence conflicti557K → N in AAF23270 (Ref. 4) Curated1
Sequence conflicti847M → V in AAF23270 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048886423S → R.Corresponds to variant rs35257416dbSNPEnsembl.1
Natural variantiVAR_021246595T → I.1 PublicationCorresponds to variant rs5744713dbSNPEnsembl.1
Natural variantiVAR_021247612I → V.Corresponds to variant rs3822587dbSNPEnsembl.1
Natural variantiVAR_048887635S → N.Corresponds to variant rs35501530dbSNPEnsembl.1
Natural variantiVAR_021248832S → N.1 PublicationCorresponds to variant rs5744716dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0128041 – 90Missing in isoform 4, isoform 7 and isoform 8. 2 PublicationsAdd BLAST90
Alternative sequenceiVSP_012803312 – 509Missing in isoform 3. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_053406453 – 489GRTVT…FAIAK → VFGYLVFPMKRTGNTNKGAL LAFYRLETKPCQPLSVH in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_012801453 – 472GRTVT…KTRAS → VLYFDMVSLVFKFFNSKMLP in isoform 2. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_012805453 – 462GRTVTIKLKN → KKYLPLLRNC in isoform 4. 1 Publication10
Alternative sequenceiVSP_053407453 – 461GRTVTIKLK → VAQVEYRRL in isoform 6 and isoform 7. 1 Publication9
Alternative sequenceiVSP_053408462 – 870Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST409
Alternative sequenceiVSP_012806463 – 870Missing in isoform 4. 1 PublicationAdd BLAST408
Alternative sequenceiVSP_012802473 – 870Missing in isoform 2. 1 PublicationAdd BLAST398
Alternative sequenceiVSP_053409490 – 870Missing in isoform 5. 1 PublicationAdd BLAST381

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027564 mRNA. Translation: BAA86943.1.
AF163570 mRNA. Translation: AAF02540.1.
AY769929 mRNA. Translation: AAV80827.1.
AY769931 mRNA. Translation: AAV80829.1.
AY769930 mRNA. Translation: AAV80828.1.
AY769932 mRNA. Translation: AAV80830.1.
AF194973 mRNA. Translation: AAF23270.1.
AF315602 mRNA. Translation: AAN15780.1.
AF318313 mRNA. Translation: AAN15781.1.
AK091659 mRNA. Translation: BAC03714.1.
AK314610 mRNA. Translation: BAG37179.1.
AY273797 Genomic DNA. Translation: AAP12648.1.
AC010245 Genomic DNA. No translation available.
AC026424 Genomic DNA. No translation available.
AC116341 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95763.1.
BC014955 mRNA. Translation: AAH14955.1.
BC050718 mRNA. Translation: AAH50718.1.
AB036934 Genomic DNA. Translation: BAB58975.1.
AB036935 Genomic DNA. Translation: BAB58976.1.
CCDSiCCDS4030.1. [Q9UBT6-1]
RefSeqiNP_057302.1. NM_016218.3. [Q9UBT6-1]
XP_016865048.1. XM_017009559.1. [Q9UBT6-1]
XP_016865049.1. XM_017009560.1. [Q9UBT6-1]
XP_016865052.1. XM_017009563.1. [Q9UBT6-8]
UniGeneiHs.135756.

Genome annotation databases

EnsembliENST00000241436; ENSP00000241436; ENSG00000122008. [Q9UBT6-1]
ENST00000504026; ENSP00000425075; ENSG00000122008. [Q9UBT6-6]
ENST00000508526; ENSP00000426853; ENSG00000122008. [Q9UBT6-3]
ENST00000509126; ENSP00000423532; ENSG00000122008. [Q9UBT6-5]
ENST00000510815; ENSP00000422094; ENSG00000122008. [Q9UBT6-4]
ENST00000515295; ENSP00000424174; ENSG00000122008. [Q9UBT6-2]
GeneIDi51426.
KEGGihsa:51426.
UCSCiuc003kdw.4. human. [Q9UBT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB027564 mRNA. Translation: BAA86943.1.
AF163570 mRNA. Translation: AAF02540.1.
AY769929 mRNA. Translation: AAV80827.1.
AY769931 mRNA. Translation: AAV80829.1.
AY769930 mRNA. Translation: AAV80828.1.
AY769932 mRNA. Translation: AAV80830.1.
AF194973 mRNA. Translation: AAF23270.1.
AF315602 mRNA. Translation: AAN15780.1.
AF318313 mRNA. Translation: AAN15781.1.
AK091659 mRNA. Translation: BAC03714.1.
AK314610 mRNA. Translation: BAG37179.1.
AY273797 Genomic DNA. Translation: AAP12648.1.
AC010245 Genomic DNA. No translation available.
AC026424 Genomic DNA. No translation available.
AC116341 Genomic DNA. No translation available.
CH471084 Genomic DNA. Translation: EAW95763.1.
BC014955 mRNA. Translation: AAH14955.1.
BC050718 mRNA. Translation: AAH50718.1.
AB036934 Genomic DNA. Translation: BAB58975.1.
AB036935 Genomic DNA. Translation: BAB58976.1.
CCDSiCCDS4030.1. [Q9UBT6-1]
RefSeqiNP_057302.1. NM_016218.3. [Q9UBT6-1]
XP_016865048.1. XM_017009559.1. [Q9UBT6-1]
XP_016865049.1. XM_017009560.1. [Q9UBT6-1]
XP_016865052.1. XM_017009563.1. [Q9UBT6-8]
UniGeneiHs.135756.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1T94X-ray2.40A/B68-526[»]
2LSINMR-B562-577[»]
2OH2X-ray3.05A/B19-526[»]
2W7OX-ray3.16A/B19-526[»]
2W7PX-ray3.71A/B19-526[»]
3IN5X-ray3.20A/B19-526[»]
3PZPX-ray3.34A/B19-528[»]
4BA9X-ray2.73A/B/C/D/E/F563-575[»]
4GK5X-ray3.21G564-573[»]
4U6PX-ray2.59A/B1-526[»]
4U7CX-ray2.80A/B27-518[»]
ProteinModelPortaliQ9UBT6.
SMRiQ9UBT6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119532. 43 interactors.
IntActiQ9UBT6. 26 interactors.
STRINGi9606.ENSP00000241436.

Chemistry databases

BindingDBiQ9UBT6.
ChEMBLiCHEMBL5365.

PTM databases

iPTMnetiQ9UBT6.
PhosphoSitePlusiQ9UBT6.

Polymorphism and mutation databases

BioMutaiPOLK.
DMDMi59798438.

Proteomic databases

EPDiQ9UBT6.
PaxDbiQ9UBT6.
PeptideAtlasiQ9UBT6.
PRIDEiQ9UBT6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241436; ENSP00000241436; ENSG00000122008. [Q9UBT6-1]
ENST00000504026; ENSP00000425075; ENSG00000122008. [Q9UBT6-6]
ENST00000508526; ENSP00000426853; ENSG00000122008. [Q9UBT6-3]
ENST00000509126; ENSP00000423532; ENSG00000122008. [Q9UBT6-5]
ENST00000510815; ENSP00000422094; ENSG00000122008. [Q9UBT6-4]
ENST00000515295; ENSP00000424174; ENSG00000122008. [Q9UBT6-2]
GeneIDi51426.
KEGGihsa:51426.
UCSCiuc003kdw.4. human. [Q9UBT6-1]

Organism-specific databases

CTDi51426.
DisGeNETi51426.
GeneCardsiPOLK.
HGNCiHGNC:9183. POLK.
HPAiHPA012035.
HPA057303.
HPA068117.
MIMi605650. gene.
neXtProtiNX_Q9UBT6.
OpenTargetsiENSG00000122008.
PharmGKBiPA33503.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2094. Eukaryota.
COG0389. LUCA.
GeneTreeiENSGT00530000062942.
HOGENOMiHOG000082711.
HOVERGENiHBG101212.
InParanoidiQ9UBT6.
KOiK03511.
OMAiNWPEDKR.
OrthoDBiEOG091G0679.
PhylomeDBiQ9UBT6.
TreeFamiTF314387.

Enzyme and pathway databases

BioCyciZFISH:HS04538-MONOMER.
ReactomeiR-HSA-5655862. Translesion synthesis by POLK.
R-HSA-5656169. Termination of translesion DNA synthesis.
R-HSA-5685942. HDR through Homologous Recombination (HRR).
R-HSA-5696397. Gap-filling DNA repair synthesis and ligation in GG-NER.
R-HSA-5696400. Dual Incision in GG-NER.
R-HSA-6782135. Dual incision in TC-NER.
R-HSA-6782210. Gap-filling DNA repair synthesis and ligation in TC-NER.

Miscellaneous databases

EvolutionaryTraceiQ9UBT6.
GeneWikiiPOLK.
GenomeRNAii51426.
PROiQ9UBT6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122008.
ExpressionAtlasiQ9UBT6. baseline and differential.
GenevisibleiQ9UBT6. HS.

Family and domain databases

Gene3Di3.30.1490.100. 1 hit.
HAMAPiMF_01113. DNApol_IV. 1 hit.
InterProiIPR017961. DNA_pol_Y-fam_little_finger.
IPR022880. DNApol_IV.
IPR024728. PolY_HhH_motif.
IPR001126. UmuC.
IPR006642. Znf_Rad18_put.
[Graphical view]
PfamiPF00817. IMS. 1 hit.
PF11799. IMS_C. 1 hit.
PF11798. IMS_HHH. 1 hit.
[Graphical view]
SMARTiSM00734. ZnF_Rad18. 2 hits.
[Graphical view]
SUPFAMiSSF100879. SSF100879. 1 hit.
PROSITEiPS50173. UMUC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPOLK_HUMAN
AccessioniPrimary (citable) accession number: Q9UBT6
Secondary accession number(s): B2RBD2
, Q5Q9G5, Q5Q9G6, Q5Q9G7, Q5Q9G8, Q86VJ8, Q8IZY0, Q8IZY1, Q8NB30, Q96L01, Q96Q86, Q96Q87, Q9UHC5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.