Q9UBP9 (GULP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PTB domain-containing engulfment adapter protein 1 Alternative name(s): Cell death protein 6 homolog PTB domain adapter protein CED-6 Protein GULP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 304 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as an adapter protein. Required for efficient phagocytosis of apoptotic cells. Modulates cellular glycosphingolipid and cholesterol transport. May play a role in the internalization and endosomal trafficking of various LRP1 ligands, such as PSAP. Increases cellular levels of GTP-bound ARF6. Ref.1 Ref.2 Ref.8 Ref.10 |
| Subunit structure | Homodimer. Interacts with clathrin. Interacts with GDP-bound ARF6, but not with GTP-bound ARF6. Part of a complex composed of GULP1, ACAP1 and ARF6. Interacts with ACAP1, LRP1, MEGF10 and STAB2. Ref.7 Ref.9 Ref.10 Ref.11 Ref.12 |
| Subcellular location | Cytoplasm. Note: May associate with the cytoplasmic side of the plasma membrane and early endosomes. Ref.8 |
| Tissue specificity | Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary. Ref.2 |
| Sequence similarities | Belongs to the ced-6 family. Contains 1 PID domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis Lipid transport Phagocytosis Transport |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | apoptotic process Traceable author statement. Source: ProtInc lipid transportInferred from electronic annotation. Source: UniProtKB-KW phagocytosis, engulfmentInferred from direct assay. Source: MGI |
| Cellular component | cytoplasm Inferred from direct assay. Source: HPA |
| Molecular function | signal transducer activity Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UBP9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UBP9-2) The sequence of this isoform differs from the canonical sequence as follows: 134-167: AEEITLTIGQAFDLAYRKFLESGGKDVETRKQIA → VSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL 168-304: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 304 | 304 | PTB domain-containing engulfment adapter protein 1 | PRO_0000296679 | |||||
Regions | |||||||||
| Domain | 21 – 176 | 156 | PID | ||||||
| Coiled coil | 158 – 202 | 45 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 213 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 223 | 1 | Phosphoserine Ref.13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 134 – 167 | 34 | AEEIT…RKQIA → VSIPDVVGWFVLFYKPGIVL LLALAKYLKMNNFL in isoform 2. | VSP_027250 | |||||
| Alternative sequence | 168 – 304 | 137 | Missing in isoform 2. | VSP_027251 | |||||
Experimental info | |||||||||
| Mutagenesis | 176 | 1 | L → P: Loss of dimerization; when associated with P-183. Ref.7 | ||||||
| Mutagenesis | 183 | 1 | L → P: Loss of dimerization; when associated with P-176. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human CED-6 encodes a functional homologue of the Caenorhabditis elegans engulfment protein CED-6." Liu Q.A., Hengartner M.O. Curr. Biol. 9:1347-1350(1999) [PubMed: 10574771] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [2] | "The human homologue of Caenorhabditis elegans CED-6 specifically promotes phagocytosis of apoptotic cells." Smits E., Van Criekinge W., Plaetinck G., Bogaert T. Curr. Biol. 9:1351-1354(1999) [PubMed: 10574763] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Trachea. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [7] | "Identification and characterization of a dimerization domain in CED-6, an adapter protein involved in engulfment of apoptotic cells." Su H.P., Brugnera E., Van Criekinge W., Smits E., Hengartner M., Bogaert T., Ravichandran K.S. J. Biol. Chem. 275:9542-9549(2000) [PubMed: 10734103] [Abstract] Cited for: SUBUNIT, MUTAGENESIS OF LEU-176 AND LEU-183. |
| [8] | "The lipoprotein receptor-related protein-1 (LRP) adapter protein GULP mediates trafficking of the LRP ligand prosaposin, leading to sphingolipid and free cholesterol accumulation in late endosomes and impaired efflux." Kiss R.S., Ma Z., Nakada-Tsukui K., Brugnera E., Vassiliou G., McBride H.M., Ravichandran K.S., Marcel Y.L. J. Biol. Chem. 281:12081-12092(2006) [PubMed: 16497666] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [9] | "Cooperation between engulfment receptors: the case of ABCA1 and MEGF10." Hamon Y., Trompier D., Ma Z., Venegas V., Pophillat M., Mignotte V., Zhou Z., Chimini G. PLoS ONE 1:E120-E120(2006) [PubMed: 17205124] [Abstract] Cited for: INTERACTION WITH MEGF10. |
| [10] | "Regulation of Arf6 and ACAP1 signaling by the PTB-domain-containing adaptor protein GULP." Ma Z., Nie Z., Luo R., Casanova J.E., Ravichandran K.S. Curr. Biol. 17:722-727(2007) [PubMed: 17398097] [Abstract] Cited for: FUNCTION, INTERACTION WITH ARF6 AND ACAP1, IDENTIFICATION IN A COMPLEX WITH ACAP1 AND ARF6. |
| [11] | "MEGF10 is a mammalian ortholog of CED-1 that interacts with clathrin assembly protein complex 2 medium chain and induces large vacuole formation." Suzuki E., Nakayama M. Exp. Cell Res. 313:3729-3742(2007) [PubMed: 17643423] [Abstract] Cited for: INTERACTION WITH MEGF10. |
| [12] | "Requirement of adaptor protein GULP during stabilin-2-mediated cell corpse engulfment." Park S.Y., Kang K.B., Thapa N., Kim S.Y., Lee S.J., Kim I.S. J. Biol. Chem. 283:10593-10600(2008) [PubMed: 18230608] [Abstract] Cited for: INTERACTION WITH STAB2. |
| [13] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-213 AND SER-223, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF200715 mRNA. Translation: AAF08006.1. AF191771 mRNA. Translation: AAF18975.1. AK314498 mRNA. Translation: BAG37098.1. AC092598 Genomic DNA. Translation: AAX93242.1. AC125490 Genomic DNA. Translation: AAY24122.1. AC104131 Genomic DNA. No translation available. AC108493 Genomic DNA. No translation available. AC133606 Genomic DNA. No translation available. CH471058 Genomic DNA. Translation: EAX10913.1. CH471058 Genomic DNA. Translation: EAX10914.1. CH471058 Genomic DNA. Translation: EAX10915.1. CH471058 Genomic DNA. Translation: EAX10917.1. BC001103 mRNA. Translation: AAH01103.1. |
| IPI | IPI00008468. IPI00790010. |
| RefSeq | NP_057399.1. NM_016315.3. |
| UniGene | Hs.470887. Hs.712910. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1AQC based on UniProtKB Q02410. |
| ProteinModelPortal | Q9UBP9. |
| SMR | Q9UBP9. Positions 13-156. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9UBP9. 3 interactions. |
| MINT | MINT-259085. |
| STRING | Q9UBP9. |
PTM databases | |
| PhosphoSite | Q9UBP9. |
Polymorphism databases | |
| DMDM | 74720076. |
Proteomic databases | |
| PRIDE | Q9UBP9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359135; ENSP00000352047; ENSG00000144366. ENST00000409580; ENSP00000386289; ENSG00000144366. ENST00000409609; ENSP00000386867; ENSG00000144366. ENST00000409830; ENSP00000386732; ENSG00000144366. |
| GeneID | 51454. |
| KEGG | hsa:51454. |
| UCSC | uc002uqc.2. human. uc002uqf.1. human. |
Organism-specific databases | |
| CTD | 51454. |
| GeneCards | GC02P189156. |
| H-InvDB | HIX0022389. |
| HGNC | HGNC:18649. GULP1. |
| HPA | HPA020587. |
| MIM | 608165. gene. |
| neXtProt | NX_Q9UBP9. |
| PharmGKB | PA134993283. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05995. |
| GeneTree | ENSGT00530000062937. |
| HOGENOM | HBG446560. |
| HOVERGEN | HBG056801. |
| InParanoid | Q9UBP9. |
| OMA | ISHQSSI. |
| OrthoDB | EOG4FR0S8. |
| PhylomeDB | Q9UBP9. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | arf6cyclingpathway. Arf6 signaling events. |
Gene expression databases | |
| ArrayExpress | Q9UBP9. |
| Bgee | Q9UBP9. |
| CleanEx | HS_GULP1. |
| Genevestigator | Q9UBP9. |
Family and domain databases | |
| InterPro | IPR011993. PH_type. IPR006020. PTyr_interaction_dom. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. |
| Pfam | PF00640. PID. 1 hit. [Graphical view] |
| SMART | SM00462. PTB. 1 hit. [Graphical view] |
| PROSITE | PS01179. PID. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 55065. |
| SOURCE | Search... |
Entry information
| Entry name | GULP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UBP9 Secondary accession number(s): B2RB51 Q9BVL3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with