Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UBM8

- MGT4C_HUMAN

UniProt

Q9UBM8 - MGT4C_HUMAN

Protein

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C

Gene

MGAT4C

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains By similarity. Does not catalyze the transfer of GlcNAc to the Manalpha1-6 arm to form GlcNAcBeta1-4Manalpha1-6 linkage ('GnT-VI' activity).By similarity1 Publication

    Catalytic activityi

    UDP-N-acetyl-D-glucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R.

    Cofactori

    Divalent metal cations.By similarity

    Pathwayi

    GO - Molecular functioni

    1. alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity Source: UniProtKB-EC
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. cellular protein metabolic process Source: Reactome
    2. post-translational protein modification Source: Reactome
    3. protein N-linked glycosylation via asparagine Source: Reactome

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Keywords - Ligandi

    Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS00017-MONOMER.
    ReactomeiREACT_25085. N-Glycan antennae elongation.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiGT54. Glycosyltransferase Family 54.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C (EC:2.4.1.145)
    Alternative name(s):
    N-acetylglucosaminyltransferase IV homolog
    Short name:
    hGnT-IV-H
    N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVc
    Short name:
    GlcNAc-T IVc
    Short name:
    GnT-IVc
    Short name:
    N-acetylglucosaminyltransferase IVc
    UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVc
    Gene namesi
    Name:MGAT4C
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:30871. MGAT4C.

    Subcellular locationi

    GO - Cellular componenti

    1. Golgi membrane Source: Reactome
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485535.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 478478Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase CPRO_0000288596Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi84 – 841N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi215 – 2151N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9UBM8.
    PRIDEiQ9UBM8.

    PTM databases

    PhosphoSiteiQ9UBM8.

    Expressioni

    Tissue specificityi

    Expressed in heart, adrenal gland, testis, liver, brain and fetal brain. Not expressed in pancreas.1 Publication

    Gene expression databases

    ArrayExpressiQ9UBM8.
    BgeeiQ9UBM8.
    CleanExiHS_MGAT4C.
    GenevestigatoriQ9UBM8.

    Organism-specific databases

    HPAiHPA016418.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000331664.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UBM8.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2323CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini45 – 478434LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei24 – 4421Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the glycosyltransferase 54 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG69242.
    HOGENOMiHOG000070065.
    HOVERGENiHBG103174.
    InParanoidiQ9UBM8.
    KOiK13748.
    OrthoDBiEOG7F24TD.
    PhylomeDBiQ9UBM8.
    TreeFamiTF324570.

    Family and domain databases

    InterProiIPR006759. Glyco_transf_54.
    [Graphical view]
    PANTHERiPTHR12062. PTHR12062. 1 hit.
    PfamiPF04666. Glyco_transf_54. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UBM8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFKFHQMKHI FEILDKMRCL RKRSTVSFLG VLVIFLLFMN LYIEDSYVLE    50
    GDKQLIRETS THQLNSERYV HTFKDLSNFS GAINVTYRYL AATPLQRKRY 100
    LTIGLSSVKR KKGNYLLETI KSIFEQSSYE ELKEISVVVH LADFNSSWRD 150
    AMVQDITQKF AHHIIAGRLM VIHAPEEYYP ILDGLKRNYN DPEDRVKFRS 200
    KQNVDYAFLL NFCANTSDYY VMLEDDVRCS KNFLTAIKKV IASLEGTYWV 250
    TLEFSKLGYI GKLYHSHDLP RLAHFLLMFY QEMPCDWLLT HFRGLLAQKN 300
    VIRFKPSLFQ HMGYYSSYKG TENKLKDDDF EEESFDIPDN PPASLYTNMN 350
    VFENYEASKA YSSVDEYFWG KPPSTGDVFV IVFENPIIIK KIKVNTGTED 400
    RQNDILHHGA LDVGENVMPS KQRRQCSTYL RLGEFKNGNF EMSGVNQKIP 450
    FDIHCMRIYV TKTQKEWLII RSISIWTS 478
    Length:478
    Mass (Da):56,061
    Last modified:May 18, 2010 - v2
    Checksum:i7D09A1BB6B6800C6
    GO
    Isoform 2 (identifier: Q9UBM8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLGKDMVRFVVRKTVQRSVAKGSRRCKKRM

    Note: No experimental confirmation available.

    Show »
    Length:507
    Mass (Da):59,465
    Checksum:iA73FDA660E5A71C3
    GO

    Sequence cautioni

    The sequence AAH26068.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti428 – 4281T → S.2 Publications
    Corresponds to variant rs17855890 [ dbSNP | Ensembl ].
    VAR_032447

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLGKDMVRFVVRKTVQRSVA KGSRRCKKRM in isoform 2. 1 PublicationVSP_056096

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB024729 mRNA. Translation: BAA83074.1.
    AB024730 mRNA. Translation: BAA83075.1.
    AB024911 Genomic DNA. Translation: BAA83087.1.
    AK299253 mRNA. Translation: BAG61284.1.
    AC010196 Genomic DNA. No translation available.
    AC016993 Genomic DNA. No translation available.
    AC025157 Genomic DNA. No translation available.
    AC079596 Genomic DNA. No translation available.
    AC079865 Genomic DNA. No translation available.
    AC087887 Genomic DNA. No translation available.
    AC093122 Genomic DNA. No translation available.
    AC128681 Genomic DNA. No translation available.
    AC139663 Genomic DNA. No translation available.
    AC139697 Genomic DNA. No translation available.
    BC026068 mRNA. Translation: AAH26068.1. Sequence problems.
    BC064141 mRNA. Translation: AAH64141.1.
    CCDSiCCDS9030.1.
    RefSeqiNP_037376.2. NM_013244.3.
    XP_005268833.1. XM_005268776.2.
    XP_005268836.1. XM_005268779.2.
    XP_005268838.1. XM_005268781.2.
    UniGeneiHs.589093.

    Genome annotation databases

    EnsembliENST00000393205; ENSP00000376900; ENSG00000182050.
    ENST00000548651; ENSP00000447253; ENSG00000182050.
    ENST00000552808; ENSP00000446647; ENSG00000182050.
    GeneIDi25834.
    KEGGihsa:25834.
    UCSCiuc001tah.4. human.

    Polymorphism databases

    DMDMi296437368.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB024729 mRNA. Translation: BAA83074.1 .
    AB024730 mRNA. Translation: BAA83075.1 .
    AB024911 Genomic DNA. Translation: BAA83087.1 .
    AK299253 mRNA. Translation: BAG61284.1 .
    AC010196 Genomic DNA. No translation available.
    AC016993 Genomic DNA. No translation available.
    AC025157 Genomic DNA. No translation available.
    AC079596 Genomic DNA. No translation available.
    AC079865 Genomic DNA. No translation available.
    AC087887 Genomic DNA. No translation available.
    AC093122 Genomic DNA. No translation available.
    AC128681 Genomic DNA. No translation available.
    AC139663 Genomic DNA. No translation available.
    AC139697 Genomic DNA. No translation available.
    BC026068 mRNA. Translation: AAH26068.1 . Sequence problems.
    BC064141 mRNA. Translation: AAH64141.1 .
    CCDSi CCDS9030.1.
    RefSeqi NP_037376.2. NM_013244.3.
    XP_005268833.1. XM_005268776.2.
    XP_005268836.1. XM_005268779.2.
    XP_005268838.1. XM_005268781.2.
    UniGenei Hs.589093.

    3D structure databases

    ProteinModelPortali Q9UBM8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000331664.

    Protein family/group databases

    CAZyi GT54. Glycosyltransferase Family 54.

    PTM databases

    PhosphoSitei Q9UBM8.

    Polymorphism databases

    DMDMi 296437368.

    Proteomic databases

    PaxDbi Q9UBM8.
    PRIDEi Q9UBM8.

    Protocols and materials databases

    DNASUi 25834.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000393205 ; ENSP00000376900 ; ENSG00000182050 .
    ENST00000548651 ; ENSP00000447253 ; ENSG00000182050 .
    ENST00000552808 ; ENSP00000446647 ; ENSG00000182050 .
    GeneIDi 25834.
    KEGGi hsa:25834.
    UCSCi uc001tah.4. human.

    Organism-specific databases

    CTDi 25834.
    GeneCardsi GC12M086372.
    H-InvDB HIX0026328.
    HGNCi HGNC:30871. MGAT4C.
    HPAi HPA016418.
    MIMi 607385. gene.
    neXtProti NX_Q9UBM8.
    PharmGKBi PA143485535.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG69242.
    HOGENOMi HOG000070065.
    HOVERGENi HBG103174.
    InParanoidi Q9UBM8.
    KOi K13748.
    OrthoDBi EOG7F24TD.
    PhylomeDBi Q9UBM8.
    TreeFami TF324570.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .
    BioCyci MetaCyc:HS00017-MONOMER.
    Reactomei REACT_25085. N-Glycan antennae elongation.

    Miscellaneous databases

    ChiTaRSi MGAT4C. human.
    GenomeRNAii 25834.
    NextBioi 47137.
    PROi Q9UBM8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UBM8.
    Bgeei Q9UBM8.
    CleanExi HS_MGAT4C.
    Genevestigatori Q9UBM8.

    Family and domain databases

    InterProi IPR006759. Glyco_transf_54.
    [Graphical view ]
    PANTHERi PTHR12062. PTHR12062. 1 hit.
    Pfami PF04666. Glyco_transf_54. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the human UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IV-homologue (hGnT-IV-H) gene."
      Furukawa T., Youssef E.M., Yatsuoka T., Yokoyama T., Makino N., Inoue H., Fukushige S., Hoshi M., Hayashi Y., Sunamura M., Horii A.
      J. Hum. Genet. 44:397-401(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT SER-428.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-428.
      Tissue: Testis.
    5. "Molecular cloning and expression of cDNA encoding chicken UDP-N-acetyl-D-glucosamine (GlcNAc): GlcNAcbeta 1-6(GlcNAcbeta 1-2)-manalpha 1-R[GlcNAc to man]beta 1,4N-acetylglucosaminyltransferase VI."
      Sakamoto Y., Taguchi T., Honke K., Korekane H., Watanabe H., Tano Y., Dohmae N., Takio K., Horii A., Taniguchi N.
      J. Biol. Chem. 275:36029-36034(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiMGT4C_HUMAN
    AccessioniPrimary (citable) accession number: Q9UBM8
    Secondary accession number(s): B4DRH2, Q4G199, Q9UIU5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 29, 2007
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 104 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3