Q9UBM1 (PEMT_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylethanolamine N-methyltransferase Short name=PEAMT Short name=PEMT EC=2.1.1.17 EC=2.1.1.71 Alternative name(s): PEMT2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 199 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Catalyzes three sequential methylation reactions of phosphatidylethanolamine (PE) by AdoMet, thereby producing phosphatidylcholine (PC). |
| Catalytic activity | S-adenosyl-L-methionine + phosphatidyl-N-methylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-dimethylethanolamine. S-adenosyl-L-methionine + phosphatidyl-N-dimethylethanolamine = S-adenosyl-L-homocysteine + phosphatidylcholine. S-adenosyl-L-methionine + phosphatidylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-methylethanolamine. |
| Enzyme regulation | The first methylation is rate-limiting. |
| Pathway | |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein Potential. Mitochondrion membrane; Multi-pass membrane protein Potential. Note: Found in endoplasmic reticulum where most PEMT activity is generated and in mitochondria By similarity. |
| Sequence similarities | Belongs to the PEMT/PEM2 methyltransferase family. |
| Sequence caution | The sequence AAF14867.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UBM1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UBM1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVM | ||||||
| Isoform 3 (identifier: Q9UBM1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVM 156-199: MHASPTGLLL...QKASGSHKRS → IPAPAGAVGS...GSPIRRALHR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 199 | 198 | Phosphatidylethanolamine N-methyltransferase | PRO_0000193920 | |||||
Regions | |||||||||
| Transmembrane | 13 – 33 | 21 | Helical; Potential | ||||||
| Transmembrane | 46 – 66 | 21 | Helical; Potential | ||||||
| Transmembrane | 94 – 114 | 21 | Helical; Potential | ||||||
| Transmembrane | 158 – 178 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MKRSGNPGAEVTNSSVAGPD CCGGLGNIDFRQADFCVM in isoform 2 and isoform 3. | VSP_037311 | |||||
| Alternative sequence | 156 – 199 | 44 | MHASP…SHKRS → IPAPAGAVGSEARQPHGPAP DGAGGPHLHSGSPIRRALHR in isoform 3. | VSP_046034 | |||||
| Natural variant | 3 | 1 | R → W. Ref.7 | VAR_055372 | |||||
| Natural variant | 58 | 1 | V → I. Ref.3 Ref.5 Ref.6 Ref.7 Ref.10 Corresponds to variant rs897453 [ dbSNP | Ensembl ]. | VAR_032771 | |||||
| Natural variant | 58 | 1 | V → L. Corresponds to variant rs897453 [ dbSNP | Ensembl ]. | VAR_060083 | |||||
| Natural variant | 175 | 1 | V → M. Ref.1 Ref.2 Ref.3 Ref.6 Ref.7 Ref.9 Ref.10 Corresponds to variant rs7946 [ dbSNP | Ensembl ]. | VAR_016093 | |||||
| Natural variant | 194 | 1 | G → R. Ref.7 | VAR_055373 | |||||
| Isoform 2: | |||||||||
| Natural variant | 11 | 1 | V → A. | ||||||
Experimental info | |||||||||
| Isoform 3: | |||||||||
| Sequence conflict | 222 | 1 | S → N in BAG63603. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of three novel cDNAs for human phosphatidylethanolamine N-methyltransferase and localization of the human gene on chromosome 17p11.2." Walkey C.J., Shields D.J., Vance D.E. Biochim. Biophys. Acta 1436:405-412(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-175. Tissue: Liver. |
| [2] | "Structure, expression profile and alternative processing of the human phosphatidylethanolamine N-methyltransferase (PEMT) gene." Shields D.J., Agellon L.B., Vance D.E. Biochim. Biophys. Acta 1532:105-114(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-175. |
| [3] | "Homo sapiens phosphatidylethanolamine N-methyltransferase mRNA." Maeda E., Watanabe M., Wang J., Kasuga M. Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ILE-58 AND MET-175. Tissue: Liver. |
| [4] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hypothalamus. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ILE-58. Tissue: Testis. |
| [6] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ILE-58 AND MET-175. |
| [7] | NIEHS SNPs program Submitted (MAR-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TRP-3; ILE-58; MET-175 AND ARG-194 (ISOFORM 1), VARIANT ALA-11 (ISOFORM 2). |
| [8] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT MET-175. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-58 AND MET-175. Tissue: Brain and Skin. |
| [11] | "Phosphatidylethanolamine N-methyltransferase (PEMT) gene expression is induced by estrogen in human and mouse primary hepatocytes." Resseguie M., Song J., Niculescu M.D., da Costa K.A., Randall T.A., Zeisel S.H. FASEB J. 21:2622-2632(2007) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF176807 mRNA. Translation: AAD53292.1. AF176806 mRNA. Translation: AAD53291.1. AF294468 AF294467 Genomic DNA. Translation: AAK19172.1.AB029821 mRNA. Translation: BAA82407.1. AF113126 mRNA. Translation: AAF14867.1. Different initiation. AK302251 mRNA. Translation: BAG63603.1. CR457099 mRNA. Translation: CAG33380.1. EU574003 Genomic DNA. Translation: ACB21050.1. AC020558 Genomic DNA. No translation available. CH471196 Genomic DNA. Translation: EAW55701.1. CH471196 Genomic DNA. Translation: EAW55702.1. BC000557 mRNA. Translation: AAH00557.1. BC050593 mRNA. Translation: AAH50593.1. |
| IPI | IPI00328909. IPI00328921. IPI00791039. |
| RefSeq | NP_001254480.1. NM_001267551.1. NP_001254481.1. NM_001267552.1. NP_009100.2. NM_007169.2. NP_680477.1. NM_148172.2. NP_680478.1. NM_148173.1. |
| UniGene | Hs.731773. |
3D structure databases | |
| ProteinModelPortal | Q9UBM1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000255389. |
Polymorphism databases | |
| DMDM | 148887406. |
Proteomic databases | |
| PaxDb | Q9UBM1. |
Protocols and materials databases | |
| DNASU | 10400. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000255389; ENSP00000255389; ENSG00000133027. ENST00000395781; ENSP00000379127; ENSG00000133027. ENST00000395782; ENSP00000379128; ENSG00000133027. ENST00000395783; ENSP00000379129; ENSG00000133027. |
| GeneID | 10400. |
| KEGG | hsa:10400. |
| UCSC | uc002grj.3. human. uc002grl.3. human. |
Organism-specific databases | |
| CTD | 10400. |
| GeneCards | GC17M017408. |
| HGNC | HGNC:8830. PEMT. |
| HPA | HPA042375. |
| MIM | 602391. gene. |
| neXtProt | NX_Q9UBM1. |
| PharmGKB | PA33175. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG261676. |
| HOVERGEN | HBG000990. |
| InParanoid | Q9UBM1. |
| KO | K00551. |
| OMA | FWNIVAR. |
| OrthoDB | EOG4V9TRP. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00753. |
Gene expression databases | |
| ArrayExpress | Q9UBM1. |
| Bgee | Q9UBM1. |
| CleanEx | HS_PEMT. HS_PNMT. |
| Genevestigator | Q9UBM1. |
| GermOnline | ENSG00000133027. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR024960. PEMT/MFAP. IPR007318. Phopholipid_MeTrfase. [Graphical view] |
| PANTHER | PTHR15458. PTHR15458. 1 hit. |
| Pfam | PF04191. PEMT. 1 hit. [Graphical view] |
| PIRSF | PIRSF005444. PEMT. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10400. |
| NextBio | 39408. |
| SOURCE | Search... |
Entry information
| Entry name | PEMT_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UBM1 Secondary accession number(s): A8MZ66 Q9Y6V9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
