SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9UBM1

- PEMT_HUMAN

UniProt

Q9UBM1 - PEMT_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phosphatidylethanolamine N-methyltransferase

Gene
PEMT, PEMPT, PNMT
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalyzes three sequential methylation reactions of phosphatidylethanolamine (PE) by AdoMet, thereby producing phosphatidylcholine (PC).

Catalytic activityi

S-adenosyl-L-methionine + phosphatidyl-N-methylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-dimethylethanolamine.
S-adenosyl-L-methionine + phosphatidyl-N-dimethylethanolamine = S-adenosyl-L-homocysteine + phosphatidylcholine.
S-adenosyl-L-methionine + phosphatidylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-methylethanolamine.

Enzyme regulationi

The first methylation is rate-limiting.

Pathwayi

GO - Molecular functioni

  1. phosphatidylethanolamine N-methyltransferase activity Source: ProtInc
  2. phosphatidyl-N-dimethylethanolamine N-methyltransferase activity Source: UniProtKB-EC
  3. phosphatidyl-N-methylethanolamine N-methyltransferase activity Source: UniProtKB-EC

GO - Biological processi

  1. cell proliferation Source: ProtInc
  2. glycerophospholipid biosynthetic process Source: Reactome
  3. lipid metabolic process Source: ProtInc
  4. phosphatidylcholine biosynthetic process Source: Reactome
  5. phospholipid metabolic process Source: Reactome
  6. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Biological processi

Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Keywords - Ligandi

S-adenosyl-L-methionine

Enzyme and pathway databases

ReactomeiREACT_121238. Synthesis of PC.
UniPathwayiUPA00753.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylethanolamine N-methyltransferase (EC:2.1.1.17, EC:2.1.1.71)
Short name:
PEAMT
Short name:
PEMT
Alternative name(s):
PEMT2
Gene namesi
Name:PEMT
Synonyms:PEMPT, PNMT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:8830. PEMT.

Subcellular locationi

Endoplasmic reticulum membrane; Multi-pass membrane protein Reviewed prediction. Mitochondrion membrane; Multi-pass membrane protein Reviewed prediction
Note: Found in endoplasmic reticulum where most PEMT activity is generated and in mitochondria By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei13 – 3321Helical; Reviewed predictionAdd
BLAST
Transmembranei46 – 6621Helical; Reviewed predictionAdd
BLAST
Transmembranei94 – 11421Helical; Reviewed predictionAdd
BLAST
Transmembranei158 – 17821Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: Reactome
  2. integral component of membrane Source: UniProtKB-KW
  3. mitochondrial membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA33175.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 199198Phosphatidylethanolamine N-methyltransferasePRO_0000193920Add
BLAST

Proteomic databases

MaxQBiQ9UBM1.
PaxDbiQ9UBM1.

Expressioni

Gene expression databases

ArrayExpressiQ9UBM1.
BgeeiQ9UBM1.
CleanExiHS_PEMT.
HS_PNMT.
GenevestigatoriQ9UBM1.

Organism-specific databases

HPAiHPA042375.

Interactioni

Protein-protein interaction databases

BioGridi115672. 1 interaction.
STRINGi9606.ENSP00000255389.

Structurei

3D structure databases

ProteinModelPortaliQ9UBM1.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG261676.
HOVERGENiHBG000990.
InParanoidiQ9UBM1.
KOiK00551.
OMAiRVTGFPF.
OrthoDBiEOG7TQV20.
PhylomeDBiQ9UBM1.
TreeFamiTF300198.

Family and domain databases

InterProiIPR024960. PEMT/MFAP.
IPR007318. Phopholipid_MeTrfase.
[Graphical view]
PANTHERiPTHR15458. PTHR15458. 1 hit.
PfamiPF04191. PEMT. 1 hit.
[Graphical view]
PIRSFiPIRSF005444. PEMT. 1 hit.
PROSITEiPS51599. SAM_PEMT_PEM2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9UBM1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTRLLGYVDP LDPSFVAAVI TITFNPLYWN VVARWEHKTR KLSRAFGSPY    50
LACYSLSVTI LLLNFLRSHC FTQAMLSQPR MESLDTPAAY SLGLALLGLG 100
VVLVLSSFFA LGFAGTFLGD YFGILKEARV TVFPFNILDN PMYWGSTANY 150
LGWAIMHASP TGLLLTVLVA LTYIVALLYE EPFTAEIYRQ KASGSHKRS 199
Length:199
Mass (Da):22,134
Last modified:June 12, 2007 - v4
Checksum:i98C07AB54B3B4E6A
GO
Isoform 2 (identifier: Q9UBM1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVM

Show »
Length:236
Mass (Da):25,890
Checksum:i024AEDF227E93FEE
GO
Isoform 3 (identifier: Q9UBM1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKRSGNPGAEVTNSSVAGPDCCGGLGNIDFRQADFCVM
     156-199: MHASPTGLLL...QKASGSHKRS → IPAPAGAVGS...GSPIRRALHR

Note: No experimental confirmation available.

Show »
Length:232
Mass (Da):24,967
Checksum:iACB01FB93D481894
GO

Sequence cautioni

The sequence AAF14867.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti3 – 31R → W.1 Publication
Corresponds to variant rs70959686 [ dbSNP | Ensembl ].
VAR_055372
Natural varianti58 – 581V → I.5 Publications
Corresponds to variant rs897453 [ dbSNP | Ensembl ].
VAR_032771
Natural varianti58 – 581V → L.
Corresponds to variant rs897453 [ dbSNP | Ensembl ].
VAR_060083
Natural varianti175 – 1751V → M.7 Publications
Corresponds to variant rs7946 [ dbSNP | Ensembl ].
VAR_016093
Natural varianti194 – 1941G → R.1 Publication
Corresponds to variant rs70965427 [ dbSNP | Ensembl ].
VAR_055373
Isoform 2 (identifier: Q9UBM1-2)
Natural varianti11 – 111V → A.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MKRSGNPGAEVTNSSVAGPD CCGGLGNIDFRQADFCVM in isoform 2 and isoform 3. VSP_037311
Alternative sequencei156 – 19944MHASP…SHKRS → IPAPAGAVGSEARQPHGPAP DGAGGPHLHSGSPIRRALHR in isoform 3. VSP_046034Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 3 (identifier: Q9UBM1-3)
Sequence conflicti222 – 2221S → N in BAG63603. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF176807 mRNA. Translation: AAD53292.1.
AF176806 mRNA. Translation: AAD53291.1.
AF294468
, AF294463, AF294464, AF294465, AF294466, AF294467 Genomic DNA. Translation: AAK19172.1.
AB029821 mRNA. Translation: BAA82407.1.
AF113126 mRNA. Translation: AAF14867.1. Different initiation.
AK302251 mRNA. Translation: BAG63603.1.
CR457099 mRNA. Translation: CAG33380.1.
EU574003 Genomic DNA. Translation: ACB21050.1.
AC020558 Genomic DNA. No translation available.
CH471196 Genomic DNA. Translation: EAW55701.1.
CH471196 Genomic DNA. Translation: EAW55702.1.
BC000557 mRNA. Translation: AAH00557.1.
BC050593 mRNA. Translation: AAH50593.1.
CCDSiCCDS11186.1. [Q9UBM1-2]
CCDS11187.1. [Q9UBM1-1]
CCDS58520.1. [Q9UBM1-3]
RefSeqiNP_001254480.1. NM_001267551.1.
NP_001254481.1. NM_001267552.1. [Q9UBM1-3]
NP_009100.2. NM_007169.2. [Q9UBM1-1]
NP_680477.1. NM_148172.2. [Q9UBM1-2]
NP_680478.1. NM_148173.1. [Q9UBM1-1]
UniGeneiHs.714193.

Genome annotation databases

EnsembliENST00000255389; ENSP00000255389; ENSG00000133027. [Q9UBM1-2]
ENST00000395781; ENSP00000379127; ENSG00000133027. [Q9UBM1-3]
ENST00000395782; ENSP00000379128; ENSG00000133027. [Q9UBM1-1]
ENST00000395783; ENSP00000379129; ENSG00000133027. [Q9UBM1-1]
GeneIDi10400.
KEGGihsa:10400.
UCSCiuc002grj.3. human. [Q9UBM1-1]
uc002grl.4. human. [Q9UBM1-2]

Polymorphism databases

DMDMi148887406.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF176807 mRNA. Translation: AAD53292.1 .
AF176806 mRNA. Translation: AAD53291.1 .
AF294468
, AF294463 , AF294464 , AF294465 , AF294466 , AF294467 Genomic DNA. Translation: AAK19172.1 .
AB029821 mRNA. Translation: BAA82407.1 .
AF113126 mRNA. Translation: AAF14867.1 . Different initiation.
AK302251 mRNA. Translation: BAG63603.1 .
CR457099 mRNA. Translation: CAG33380.1 .
EU574003 Genomic DNA. Translation: ACB21050.1 .
AC020558 Genomic DNA. No translation available.
CH471196 Genomic DNA. Translation: EAW55701.1 .
CH471196 Genomic DNA. Translation: EAW55702.1 .
BC000557 mRNA. Translation: AAH00557.1 .
BC050593 mRNA. Translation: AAH50593.1 .
CCDSi CCDS11186.1. [Q9UBM1-2 ]
CCDS11187.1. [Q9UBM1-1 ]
CCDS58520.1. [Q9UBM1-3 ]
RefSeqi NP_001254480.1. NM_001267551.1.
NP_001254481.1. NM_001267552.1. [Q9UBM1-3 ]
NP_009100.2. NM_007169.2. [Q9UBM1-1 ]
NP_680477.1. NM_148172.2. [Q9UBM1-2 ]
NP_680478.1. NM_148173.1. [Q9UBM1-1 ]
UniGenei Hs.714193.

3D structure databases

ProteinModelPortali Q9UBM1.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115672. 1 interaction.
STRINGi 9606.ENSP00000255389.

Polymorphism databases

DMDMi 148887406.

Proteomic databases

MaxQBi Q9UBM1.
PaxDbi Q9UBM1.

Protocols and materials databases

DNASUi 10400.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000255389 ; ENSP00000255389 ; ENSG00000133027 . [Q9UBM1-2 ]
ENST00000395781 ; ENSP00000379127 ; ENSG00000133027 . [Q9UBM1-3 ]
ENST00000395782 ; ENSP00000379128 ; ENSG00000133027 . [Q9UBM1-1 ]
ENST00000395783 ; ENSP00000379129 ; ENSG00000133027 . [Q9UBM1-1 ]
GeneIDi 10400.
KEGGi hsa:10400.
UCSCi uc002grj.3. human. [Q9UBM1-1 ]
uc002grl.4. human. [Q9UBM1-2 ]

Organism-specific databases

CTDi 10400.
GeneCardsi GC17M017408.
HGNCi HGNC:8830. PEMT.
HPAi HPA042375.
MIMi 602391. gene.
neXtProti NX_Q9UBM1.
PharmGKBi PA33175.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG261676.
HOVERGENi HBG000990.
InParanoidi Q9UBM1.
KOi K00551.
OMAi RVTGFPF.
OrthoDBi EOG7TQV20.
PhylomeDBi Q9UBM1.
TreeFami TF300198.

Enzyme and pathway databases

UniPathwayi UPA00753 .
Reactomei REACT_121238. Synthesis of PC.

Miscellaneous databases

GeneWikii Phosphatidyl_ethanolamine_methyltransferase.
GenomeRNAii 10400.
NextBioi 39408.
PROi Q9UBM1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9UBM1.
Bgeei Q9UBM1.
CleanExi HS_PEMT.
HS_PNMT.
Genevestigatori Q9UBM1.

Family and domain databases

InterProi IPR024960. PEMT/MFAP.
IPR007318. Phopholipid_MeTrfase.
[Graphical view ]
PANTHERi PTHR15458. PTHR15458. 1 hit.
Pfami PF04191. PEMT. 1 hit.
[Graphical view ]
PIRSFi PIRSF005444. PEMT. 1 hit.
PROSITEi PS51599. SAM_PEMT_PEM2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of three novel cDNAs for human phosphatidylethanolamine N-methyltransferase and localization of the human gene on chromosome 17p11.2."
    Walkey C.J., Shields D.J., Vance D.E.
    Biochim. Biophys. Acta 1436:405-412(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-175.
    Tissue: Liver.
  2. "Structure, expression profile and alternative processing of the human phosphatidylethanolamine N-methyltransferase (PEMT) gene."
    Shields D.J., Agellon L.B., Vance D.E.
    Biochim. Biophys. Acta 1532:105-114(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT MET-175.
  3. "Homo sapiens phosphatidylethanolamine N-methyltransferase mRNA."
    Maeda E., Watanabe M., Wang J., Kasuga M.
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS ILE-58 AND MET-175.
    Tissue: Liver.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hypothalamus.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ILE-58.
    Tissue: Testis.
  6. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ILE-58 AND MET-175.
  7. NIEHS SNPs program
    Submitted (MAR-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TRP-3; ILE-58; MET-175 AND ARG-194 (ISOFORM 1), VARIANT ALA-11 (ISOFORM 2).
  8. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT MET-175.
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS ILE-58 AND MET-175.
    Tissue: Brain and Skin.
  11. "Phosphatidylethanolamine N-methyltransferase (PEMT) gene expression is induced by estrogen in human and mouse primary hepatocytes."
    Resseguie M., Song J., Niculescu M.D., da Costa K.A., Randall T.A., Zeisel S.H.
    FASEB J. 21:2622-2632(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING.

Entry informationi

Entry nameiPEMT_HUMAN
AccessioniPrimary (citable) accession number: Q9UBM1
Secondary accession number(s): A8MZ66
, B4DY41, D3DXC3, Q6IAQ5, Q86VL3, Q9BW86, Q9UHY6, Q9Y6V9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: June 12, 2007
Last modified: September 3, 2014
This is version 116 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi