Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

cAMP-regulated phosphoprotein 21

Gene

ARPP21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 2 may act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000172995-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
cAMP-regulated phosphoprotein 21
Short name:
ARPP-21
Alternative name(s):
Thymocyte cAMP-regulated phosphoprotein
Gene namesi
Name:ARPP21
Synonyms:TARPP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:16968. ARPP21.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi10777.
OpenTargetsiENSG00000172995.

Polymorphism and mutation databases

BioMutaiARPP21.
DMDMi160332340.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000646822 – 812cAMP-regulated phosphoprotein 21Add BLAST811

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei33PhosphoserineCombined sources1
Modified residuei56PhosphoserineBy similarity1
Modified residuei134PhosphoserineBy similarity1
Modified residuei300PhosphoserineBy similarity1
Modified residuei363PhosphoserineBy similarity1
Modified residuei383PhosphoserineCombined sources1
Modified residuei562PhosphoserineCombined sources1
Modified residuei655Omega-N-methylated arginine1 Publication1

Post-translational modificationi

Phosphorylation at Ser-56 favors interaction with CALM1.By similarity
Isoform 1 is methylated by CARM1 in immature thymocytes.1 Publication

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ9UBL0.
PaxDbiQ9UBL0.
PeptideAtlasiQ9UBL0.
PRIDEiQ9UBL0.

PTM databases

iPTMnetiQ9UBL0.
PhosphoSitePlusiQ9UBL0.

Miscellaneous databases

PMAP-CutDBQ9UBL0.

Expressioni

Tissue specificityi

Isoform 2 is expressed in brain. Isoform 1 is present in immature thymocytes (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000172995.
ExpressionAtlasiQ9UBL0. baseline and differential.
GenevisibleiQ9UBL0. HS.

Organism-specific databases

HPAiHPA017303.

Interactioni

Subunit structurei

Interacts with CALM1.By similarity

Protein-protein interaction databases

BioGridi115995. 3 interactors.
IntActiQ9UBL0. 2 interactors.
STRINGi9606.ENSP00000187397.

Structurei

3D structure databases

ProteinModelPortaliQ9UBL0.
SMRiQ9UBL0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini164 – 227R3HPROSITE-ProRule annotationAdd BLAST64
Domaini228 – 300SUZPROSITE-ProRule annotationAdd BLAST73

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili32 – 58Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi338 – 423Ser-richAdd BLAST86
Compositional biasi506 – 754Gln-richAdd BLAST249

Sequence similaritiesi

Contains 1 R3H domain.PROSITE-ProRule annotation
Contains 1 SUZ domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2953. Eukaryota.
ENOG4111U9N. LUCA.
GeneTreeiENSGT00440000038338.
HOVERGENiHBG052192.
InParanoidiQ9UBL0.
OMAiCRTNCAS.
OrthoDBiEOG091G016L.
PhylomeDBiQ9UBL0.
TreeFamiTF315915.

Family and domain databases

Gene3Di3.30.1370.50. 1 hit.
InterProiIPR001374. R3H_dom.
IPR024771. SUZ.
[Graphical view]
PfamiPF01424. R3H. 1 hit.
PF12752. SUZ. 1 hit.
[Graphical view]
SMARTiSM00393. R3H. 1 hit.
[Graphical view]
SUPFAMiSSF82708. SSF82708. 1 hit.
PROSITEiPS51061. R3H. 1 hit.
PS51673. SUZ. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBL0-1) [UniParc]FASTAAdd to basket
Also known as: TARPP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQGDLNQA IAEEGGTEQE TATPENGIVK SESLDEEEKL ELQRRLEAQN
60 70 80 90 100
QERRKSKSGA GKGKLTRSLA VCEESSARPG GESLQDQESI HLQLSSFSSL
110 120 130 140 150
QEEDKSRKDD SEREKEKDKN KDKTSEKPKI RMLSKDCSQE YTDSTGIDLH
160 170 180 190 200
EFLINTLKNN SRDRMILLKM EQEIIDFIAD NNNHYKKFPQ MSSYQRMLVH
210 220 230 240 250
RVAAYFGLDH NVDQTGKSVI INKTSSTRIP EQRFCEHLKD EKGEESQKRF
260 270 280 290 300
ILKRDNSSID KEDNQQNRMH PFRDDRRSKS IEEREEEYQR VRERIFAHDS
310 320 330 340 350
VCSQESLFVE NSRLLEDSNI CNETYKKRQL FRGNRDGSGR TSGSRQSSSE
360 370 380 390 400
NELKWSDHQR AWSSTDSDSS NRNLKPAMTK TASFGGITVL TRGDSTSSTR
410 420 430 440 450
STGKLSKAGS ESSSSAGSSG SLSRTHPPLQ STPLVSGVAA GSPGCVPYPE
460 470 480 490 500
NGIGGQVAPS STSYILLPLE AATGIPPGSI LLNPHTGQPF VNPDGTPAIY
510 520 530 540 550
NPPTSQQPLR SAMVGQSQQQ PPQQQPSPQP QQQVQPPQPQ MAGPLVTQRD
560 570 580 590 600
DVATQFGQMT LSRQSSGETP EPPSGPVYPS SLMPQPAQQP SYVIASTGQQ
610 620 630 640 650
LPTGGFSGSG PPISQQVLQP PPSPQGFVQQ PPPAQMPVYY YPSGQYPTST
660 670 680 690 700
TQQYRPMAPV QYNAQRSQQM PQAAQQAGYQ PVLSGQQGFQ GLIGVQQPPQ
710 720 730 740 750
SQNVINNQQG TPVQSVMVSY PTMSSYQVPM TQGSQGLPQQ SYQQPIMLPN
760 770 780 790 800
QAGQGSLPAT GMPVYCNVTP PTPQNNLRLI GPHCPSSTVP VMSASCRTNC
810
ASMSNAGWQV KF
Length:812
Mass (Da):89,196
Last modified:November 13, 2007 - v2
Checksum:i73981A8341BB3359
GO
Isoform 2 (identifier: Q9UBL0-2) [UniParc]FASTAAdd to basket
Also known as: ARPP-21

The sequence of this isoform differs from the canonical sequence as follows:
     88-89: ES → TL
     90-812: Missing.

Show »
Length:89
Mass (Da):9,674
Checksum:i94654817C61B4C94
GO
Isoform 3 (identifier: Q9UBL0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-299: Missing.
     548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM

Show »
Length:813
Mass (Da):88,570
Checksum:i1F6E07737C11CC45
GO
Isoform 4 (identifier: Q9UBL0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-299: Missing.
     312-331: Missing.
     548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM

Show »
Length:793
Mass (Da):86,131
Checksum:iF523AEF3E39114BE
GO
Isoform 5 (identifier: Q9UBL0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-512: Missing.
     548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM

Note: No experimental confirmation available.
Show »
Length:335
Mass (Da):35,931
Checksum:i3AF26F827EDD5066
GO
Isoform 6 (identifier: Q9UBL0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-108: ESIHLQLSSFSSLQEEDKSRK → VYPLAIIINCMNGIHLCVHDS
     109-812: Missing.

Note: No experimental confirmation available.
Show »
Length:108
Mass (Da):11,768
Checksum:i2AABF43866F7CCE8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti312Missing in CAB61414 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0294691 – 512Missing in isoform 5. 1 PublicationAdd BLAST512
Alternative sequenceiVSP_02947088 – 108ESIHL…DKSRK → VYPLAIIINCMNGIHLCVHD S in isoform 6. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_02947188 – 89ES → TL in isoform 2. 3 Publications2
Alternative sequenceiVSP_02947290 – 812Missing in isoform 2. 3 PublicationsAdd BLAST723
Alternative sequenceiVSP_029473109 – 812Missing in isoform 6. 1 PublicationAdd BLAST704
Alternative sequenceiVSP_029474266 – 299Missing in isoform 3 and isoform 4. 3 PublicationsAdd BLAST34
Alternative sequenceiVSP_029475312 – 331Missing in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_029476548Q → QSVQGLQASSQSVQYPAVSF PPQHLLPVSPTQHFPM in isoform 3, isoform 4 and isoform 5. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF112220 mRNA. Translation: AAF17207.1.
AK294484 mRNA. Translation: BAG57707.1.
CH471055 Genomic DNA. Translation: EAW64471.1.
BC017805 mRNA. Translation: AAH17805.1.
BC031106 mRNA. Translation: AAH31106.1.
BC036399 mRNA. Translation: AAH36399.1.
BC041385 mRNA. Translation: AAH41385.1.
BC051828 mRNA. Translation: AAH51828.1.
BC066651 mRNA. Translation: AAH66651.1.
AL133109 mRNA. Translation: CAB61414.1.
CCDSiCCDS2661.1. [Q9UBL0-1]
CCDS43063.1. [Q9UBL0-2]
CCDS58823.1. [Q9UBL0-3]
CCDS58824.1. [Q9UBL0-4]
PIRiT42644.
RefSeqiNP_001020239.1. NM_001025068.1. [Q9UBL0-2]
NP_001020240.1. NM_001025069.1. [Q9UBL0-2]
NP_001254545.1. NM_001267616.1. [Q9UBL0-2]
NP_001254546.1. NM_001267617.1. [Q9UBL0-4]
NP_001254547.1. NM_001267618.1. [Q9UBL0-2]
NP_001254548.1. NM_001267619.1. [Q9UBL0-3]
NP_057384.2. NM_016300.4. [Q9UBL0-1]
NP_938409.1. NM_198399.1. [Q9UBL0-2]
XP_006713006.1. XM_006712943.2. [Q9UBL0-3]
XP_006713007.1. XM_006712944.2. [Q9UBL0-4]
XP_016861081.1. XM_017005592.1. [Q9UBL0-3]
XP_016861082.1. XM_017005593.1. [Q9UBL0-3]
XP_016861083.1. XM_017005594.1. [Q9UBL0-3]
XP_016861084.1. XM_017005595.1. [Q9UBL0-3]
XP_016861091.1. XM_017005602.1. [Q9UBL0-4]
XP_016861092.1. XM_017005603.1. [Q9UBL0-4]
XP_016861093.1. XM_017005604.1. [Q9UBL0-4]
XP_016861094.1. XM_017005605.1. [Q9UBL0-4]
XP_016861095.1. XM_017005606.1. [Q9UBL0-4]
UniGeneiHs.475902.

Genome annotation databases

EnsembliENST00000187397; ENSP00000187397; ENSG00000172995. [Q9UBL0-1]
ENST00000396481; ENSP00000379741; ENSG00000172995. [Q9UBL0-2]
ENST00000396482; ENSP00000379742; ENSG00000172995. [Q9UBL0-2]
ENST00000412048; ENSP00000390151; ENSG00000172995. [Q9UBL0-2]
ENST00000417925; ENSP00000412326; ENSG00000172995. [Q9UBL0-3]
ENST00000427542; ENSP00000401602; ENSG00000172995. [Q9UBL0-2]
ENST00000428373; ENSP00000412411; ENSG00000172995. [Q9UBL0-2]
ENST00000432682; ENSP00000389754; ENSG00000172995. [Q9UBL0-2]
ENST00000436702; ENSP00000397720; ENSG00000172995. [Q9UBL0-2]
ENST00000438071; ENSP00000410171; ENSG00000172995. [Q9UBL0-2]
ENST00000441454; ENSP00000406964; ENSG00000172995. [Q9UBL0-2]
ENST00000444190; ENSP00000405276; ENSG00000172995. [Q9UBL0-4]
ENST00000474696; ENSP00000417838; ENSG00000172995. [Q9UBL0-2]
GeneIDi10777.
KEGGihsa:10777.
UCSCiuc003cfz.5. human. [Q9UBL0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF112220 mRNA. Translation: AAF17207.1.
AK294484 mRNA. Translation: BAG57707.1.
CH471055 Genomic DNA. Translation: EAW64471.1.
BC017805 mRNA. Translation: AAH17805.1.
BC031106 mRNA. Translation: AAH31106.1.
BC036399 mRNA. Translation: AAH36399.1.
BC041385 mRNA. Translation: AAH41385.1.
BC051828 mRNA. Translation: AAH51828.1.
BC066651 mRNA. Translation: AAH66651.1.
AL133109 mRNA. Translation: CAB61414.1.
CCDSiCCDS2661.1. [Q9UBL0-1]
CCDS43063.1. [Q9UBL0-2]
CCDS58823.1. [Q9UBL0-3]
CCDS58824.1. [Q9UBL0-4]
PIRiT42644.
RefSeqiNP_001020239.1. NM_001025068.1. [Q9UBL0-2]
NP_001020240.1. NM_001025069.1. [Q9UBL0-2]
NP_001254545.1. NM_001267616.1. [Q9UBL0-2]
NP_001254546.1. NM_001267617.1. [Q9UBL0-4]
NP_001254547.1. NM_001267618.1. [Q9UBL0-2]
NP_001254548.1. NM_001267619.1. [Q9UBL0-3]
NP_057384.2. NM_016300.4. [Q9UBL0-1]
NP_938409.1. NM_198399.1. [Q9UBL0-2]
XP_006713006.1. XM_006712943.2. [Q9UBL0-3]
XP_006713007.1. XM_006712944.2. [Q9UBL0-4]
XP_016861081.1. XM_017005592.1. [Q9UBL0-3]
XP_016861082.1. XM_017005593.1. [Q9UBL0-3]
XP_016861083.1. XM_017005594.1. [Q9UBL0-3]
XP_016861084.1. XM_017005595.1. [Q9UBL0-3]
XP_016861091.1. XM_017005602.1. [Q9UBL0-4]
XP_016861092.1. XM_017005603.1. [Q9UBL0-4]
XP_016861093.1. XM_017005604.1. [Q9UBL0-4]
XP_016861094.1. XM_017005605.1. [Q9UBL0-4]
XP_016861095.1. XM_017005606.1. [Q9UBL0-4]
UniGeneiHs.475902.

3D structure databases

ProteinModelPortaliQ9UBL0.
SMRiQ9UBL0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115995. 3 interactors.
IntActiQ9UBL0. 2 interactors.
STRINGi9606.ENSP00000187397.

PTM databases

iPTMnetiQ9UBL0.
PhosphoSitePlusiQ9UBL0.

Polymorphism and mutation databases

BioMutaiARPP21.
DMDMi160332340.

Proteomic databases

MaxQBiQ9UBL0.
PaxDbiQ9UBL0.
PeptideAtlasiQ9UBL0.
PRIDEiQ9UBL0.

Protocols and materials databases

DNASUi10777.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000187397; ENSP00000187397; ENSG00000172995. [Q9UBL0-1]
ENST00000396481; ENSP00000379741; ENSG00000172995. [Q9UBL0-2]
ENST00000396482; ENSP00000379742; ENSG00000172995. [Q9UBL0-2]
ENST00000412048; ENSP00000390151; ENSG00000172995. [Q9UBL0-2]
ENST00000417925; ENSP00000412326; ENSG00000172995. [Q9UBL0-3]
ENST00000427542; ENSP00000401602; ENSG00000172995. [Q9UBL0-2]
ENST00000428373; ENSP00000412411; ENSG00000172995. [Q9UBL0-2]
ENST00000432682; ENSP00000389754; ENSG00000172995. [Q9UBL0-2]
ENST00000436702; ENSP00000397720; ENSG00000172995. [Q9UBL0-2]
ENST00000438071; ENSP00000410171; ENSG00000172995. [Q9UBL0-2]
ENST00000441454; ENSP00000406964; ENSG00000172995. [Q9UBL0-2]
ENST00000444190; ENSP00000405276; ENSG00000172995. [Q9UBL0-4]
ENST00000474696; ENSP00000417838; ENSG00000172995. [Q9UBL0-2]
GeneIDi10777.
KEGGihsa:10777.
UCSCiuc003cfz.5. human. [Q9UBL0-1]

Organism-specific databases

CTDi10777.
DisGeNETi10777.
GeneCardsiARPP21.
HGNCiHGNC:16968. ARPP21.
HPAiHPA017303.
MIMi605488. gene.
neXtProtiNX_Q9UBL0.
OpenTargetsiENSG00000172995.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2953. Eukaryota.
ENOG4111U9N. LUCA.
GeneTreeiENSGT00440000038338.
HOVERGENiHBG052192.
InParanoidiQ9UBL0.
OMAiCRTNCAS.
OrthoDBiEOG091G016L.
PhylomeDBiQ9UBL0.
TreeFamiTF315915.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000172995-MONOMER.

Miscellaneous databases

ChiTaRSiARPP21. human.
GeneWikiiARPP-21.
GenomeRNAii10777.
PMAP-CutDBQ9UBL0.
PROiQ9UBL0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172995.
ExpressionAtlasiQ9UBL0. baseline and differential.
GenevisibleiQ9UBL0. HS.

Family and domain databases

Gene3Di3.30.1370.50. 1 hit.
InterProiIPR001374. R3H_dom.
IPR024771. SUZ.
[Graphical view]
PfamiPF01424. R3H. 1 hit.
PF12752. SUZ. 1 hit.
[Graphical view]
SMARTiSM00393. R3H. 1 hit.
[Graphical view]
SUPFAMiSSF82708. SSF82708. 1 hit.
PROSITEiPS51061. R3H. 1 hit.
PS51673. SUZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARP21_HUMAN
AccessioniPrimary (citable) accession number: Q9UBL0
Secondary accession number(s): B4DG96
, Q49AK3, Q49AS6, Q4G0V4, Q6NYC3, Q86V31, Q9UF93
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: November 13, 2007
Last modified: November 2, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.