Q9UBL0 (ARP21_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: cAMP-regulated phosphoprotein 21 Short name=ARPP-21 Alternative name(s): Thymocyte cAMP-regulated phosphoprotein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 812 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 2 may act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons By similarity. |
| Subunit structure | Interacts with CALM1 By similarity. |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Isoform 2 is expressed in brain. Isoform 1 is present in immature thymocytes (at protein level). Ref.1 Ref.8 |
| Post-translational modification | Phosphorylation at Ser-56 favors interaction with CALM1 By similarity. Isoform 1 is methylated by CARM1 in immature thymocytes Probable. Ref.8 |
| Sequence similarities | Contains 1 R3H domain. Contains 1 SUZ domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | Calmodulin-binding |
| PTM | Acetylation Methylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular response to heat Inferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | nucleic acid binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UBL0-1) Also known as: TARPP; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UBL0-2) Also known as: ARPP-21; The sequence of this isoform differs from the canonical sequence as follows: 88-89: ES → TL 90-812: Missing. | ||||||
| Isoform 3 (identifier: Q9UBL0-3) The sequence of this isoform differs from the canonical sequence as follows: 266-299: Missing. 548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM | ||||||
| Isoform 4 (identifier: Q9UBL0-4) The sequence of this isoform differs from the canonical sequence as follows: 266-299: Missing. 312-331: Missing. 548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM | ||||||
| Isoform 5 (identifier: Q9UBL0-5) The sequence of this isoform differs from the canonical sequence as follows: 1-512: Missing. 548-548: Q → QSVQGLQASSQSVQYPAVSFPPQHLLPVSPTQHFPM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9UBL0-6) The sequence of this isoform differs from the canonical sequence as follows: 88-108: ESIHLQLSSFSSLQEEDKSRK → VYPLAIIINCMNGIHLCVHDS 109-812: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 812 | 811 | cAMP-regulated phosphoprotein 21 | PRO_0000064682 | |||||
Regions | |||||||||
| Domain | 164 – 227 | 64 | R3H | ||||||
| Domain | 245 – 299 | 55 | SUZ | ||||||
| Coiled coil | 32 – 58 | 27 | Potential | ||||||
| Compositional bias | 338 – 423 | 86 | Ser-rich | ||||||
| Compositional bias | 506 – 754 | 249 | Gln-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylserine By similarity | ||||||
| Modified residue | 33 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 56 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 280 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 383 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 562 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 655 | 1 | Omega-N-methylated arginine Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 512 | 512 | Missing in isoform 5. | VSP_029469 | |||||
| Alternative sequence | 88 – 108 | 21 | ESIHL…DKSRK → VYPLAIIINCMNGIHLCVHD S in isoform 6. | VSP_029470 | |||||
| Alternative sequence | 88 – 89 | 2 | ES → TL in isoform 2. | VSP_029471 | |||||
| Alternative sequence | 90 – 812 | 723 | Missing in isoform 2. | VSP_029472 | |||||
| Alternative sequence | 109 – 812 | 704 | Missing in isoform 6. | VSP_029473 | |||||
| Alternative sequence | 266 – 299 | 34 | Missing in isoform 3 and isoform 4. | VSP_029474 | |||||
| Alternative sequence | 312 – 331 | 20 | Missing in isoform 4. | VSP_029475 | |||||
| Alternative sequence | 548 | 1 | Q → QSVQGLQASSQSVQYPAVSF PPQHLLPVSPTQHFPM in isoform 3, isoform 4 and isoform 5. | VSP_029476 | |||||
Experimental info | |||||||||
| Sequence conflict | 312 | 1 | Missing in CAB61414. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning." Hu R.-M., Han Z.-G., Song H.-D., Peng Y.-D., Huang Q.-H., Ren S.-X., Gu Y.-J., Huang C.-H., Li Y.-B., Jiang C.-L., Fu G., Zhang Q.-H., Gu B.-W., Dai M., Mao Y.-F., Gao G.-F., Rong R., Ye M. Chen J.-L.Proc. Natl. Acad. Sci. U.S.A. 97:9543-9548(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Hypothalamus. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Amygdala. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4; 5 AND 6). Tissue: Hippocampus, Lung and Testis. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 162-812 (ISOFORM 3). Tissue: Kidney. |
| [7] | "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry." Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C. Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [8] | "Loss of CARM1 results in hypomethylation of thymocyte cyclic AMP-regulated phosphoprotein and deregulated early T cell development." Kim J., Lee J., Yadav N., Wu Q., Carter C., Richard S., Richie E., Bedford M.T. J. Biol. Chem. 279:25339-25344(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, METHYLATION AT ARG-655. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33; SER-383 AND SER-562, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | ARP21_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UBL0 Secondary accession number(s): B4DG96 Q9UF93 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
