Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Stomatin-like protein 1

Gene

STOML1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Stomatin-like protein 1
Short name:
SLP-1
Alternative name(s):
EPB72-like protein 1
Protein unc-24 homolog
Stomatin-related protein
Short name:
STORP
Gene namesi
Name:STOML1
Synonyms:SLP1, UNC24
ORF Names:MSTP019
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:14560. STOML1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei58 – 7821Helical; Signal-anchor for type III membrane proteinSequence AnalysisAdd
BLAST
Topological domaini79 – 398320CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37898.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 398398Stomatin-like protein 1PRO_0000094029Add
BLAST

Proteomic databases

MaxQBiQ9UBI4.
PaxDbiQ9UBI4.
PRIDEiQ9UBI4.

PTM databases

PhosphoSiteiQ9UBI4.

Expressioni

Tissue specificityi

Ubiquitously expressed at low levels. Expression is highest in brain.2 Publications

Gene expression databases

BgeeiQ9UBI4.
CleanExiHS_STOML1.
ExpressionAtlasiQ9UBI4. baseline and differential.
GenevestigatoriQ9UBI4.

Organism-specific databases

HPAiHPA042353.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CDK2P249412EBI-2681162,EBI-375096
FBXW7Q969H0-43EBI-2681162,EBI-6502391

Protein-protein interaction databases

BioGridi114796. 8 interactions.
IntActiQ9UBI4. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9UBI4.
SMRiQ9UBI4. Positions 117-217, 306-391.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini287 – 398112SCP2Add
BLAST

Sequence similaritiesi

Belongs to the band 7/mec-2 family.Curated
Contains 1 SCP2 domain.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0330.
GeneTreeiENSGT00550000074454.
HOGENOMiHOG000065698.
HOVERGENiHBG079220.
InParanoidiQ9UBI4.
OMAiPLREIQM.
OrthoDBiEOG7KSX8R.
PhylomeDBiQ9UBI4.
TreeFamiTF105750.

Family and domain databases

Gene3Di3.30.1050.10. 1 hit.
InterProiIPR001107. Band_7.
IPR003033. SCP2_sterol-bd_dom.
IPR028517. SLP1.
IPR001972. Stomatin_fam.
[Graphical view]
PANTHERiPTHR10264. PTHR10264. 1 hit.
PTHR10264:SF70. PTHR10264:SF70. 1 hit.
PfamiPF01145. Band_7. 1 hit.
PF02036. SCP2. 1 hit.
[Graphical view]
PRINTSiPR00721. STOMATIN.
SMARTiSM00244. PHB. 1 hit.
[Graphical view]
SUPFAMiSSF55718. SSF55718. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGRSGYRAL PLGDFDRFQQ SSFGFLGSQK GCLSPERGGV GTGADVPQSW
60 70 80 90 100
PSCLCHGLIS FLGFLLLLVT FPISGWFALK IVPTYERMIV FRLGRIRTPQ
110 120 130 140 150
GPGMVLLLPF IDSFQRVDLR TRAFNVPPCK LASKDGAVLS VGADVQFRIW
160 170 180 190 200
DPVLSVMTVK DLNTATRMTA QNAMTKALLK RPLREIQMEK LKISDQLLLE
210 220 230 240 250
INDVTRAWGL EVDRVELAVE AVLQPPQDSP AGPNLDSTLQ QLALHFLGGS
260 270 280 290 300
MNSMAGGAPS PGPADTVEMV SEVEPPAPQV GARSSPKQPL AEGLLTALQP
310 320 330 340 350
FLSEALVSQV GACYQFNVVL PSGTQSAYFL DLTTGRGRVG HGVPDGIPDV
360 370 380 390
VVEMAEADLR ALLCRELRPL GAYMSGRLKV KGDLAMAMKL EAVLRALK
Length:398
Mass (Da):42,968
Last modified:April 30, 2000 - v1
Checksum:iA9850C26394E1C3D
GO
Isoform 2 (identifier: Q9UBI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-129: Missing.

Show »
Length:348
Mass (Da):37,170
Checksum:i436B02A898059006
GO
Isoform 3 (identifier: Q9UBI4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     264-264: Missing.

Show »
Length:397
Mass (Da):42,897
Checksum:iD88DFC8B3AB37397
GO
Isoform 4 (identifier: Q9UBI4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-129: Missing.
     264-264: Missing.

Note: No experimental confirmation available.

Show »
Length:347
Mass (Da):37,099
Checksum:i2683722A713F4830
GO
Isoform 5 (identifier: Q9UBI4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGA → MP
     264-264: Missing.

Note: No experimental confirmation available.

Show »
Length:355
Mass (Da):38,534
Checksum:i59AB1BE8E1A34A9A
GO
Isoform 6 (identifier: Q9UBI4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     264-264: Missing.
     265-334: Missing.

Note: No experimental confirmation available.

Show »
Length:327
Mass (Da):35,520
Checksum:i7910E73D608CEED9
GO

Sequence cautioni

The sequence AAD42031.1 differs from that shown. Reason: Frameshift at positions 201 and 210. Curated
The sequence CAA76271.1 differs from that shown. Reason: Frameshift at positions 230, 233, 263, 292 and 300. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti50 – 501W → G in CAG46886 (Ref. 5) Curated
Sequence conflicti222 – 2221V → L in AAL39002 (Ref. 3) Curated
Sequence conflicti291 – 2911A → T in CAG46886 (Ref. 5) Curated
Sequence conflicti369 – 3691P → R in CAA76271 (PubMed:9931417).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4444MLGRS…VGTGA → MP in isoform 5. 1 PublicationVSP_054648Add
BLAST
Alternative sequencei80 – 12950Missing in isoform 2 and isoform 4. 3 PublicationsVSP_012654Add
BLAST
Alternative sequencei264 – 2641Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 4 PublicationsVSP_054649
Alternative sequencei265 – 33470Missing in isoform 6. 1 PublicationVSP_054650Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16522 mRNA. Translation: CAA76271.1. Frameshift.
AF156564
, AF156558, AF156560, AF156559, AF156563, AF156562, AF156561 Genomic DNA. Translation: AAF23080.1.
AF156557 mRNA. Translation: AAF06960.1.
AF111800 mRNA. Translation: AAL39002.1.
DQ064605 mRNA. Translation: AAY68393.1.
CR542089 mRNA. Translation: CAG46886.1.
AK300799 mRNA. Translation: BAG62457.1.
AK302051 mRNA. Translation: BAG63441.1.
AK075244 mRNA. Translation: BAG52092.1.
AC108137 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77940.1.
CH471082 Genomic DNA. Translation: EAW77944.1.
BC034379 mRNA. Translation: AAH34379.1.
BC065249 mRNA. Translation: AAH65249.1.
AF074953 mRNA. Translation: AAD42031.1. Frameshift.
AL109664 mRNA. Translation: CAB52015.1.
AL109665 mRNA. Translation: CAB52016.1.
CCDSiCCDS10254.1. [Q9UBI4-1]
CCDS58382.1. [Q9UBI4-5]
CCDS58383.1. [Q9UBI4-4]
CCDS58384.1. [Q9UBI4-2]
CCDS58385.1. [Q9UBI4-6]
RefSeqiNP_001243601.1. NM_001256672.1. [Q9UBI4-3]
NP_001243602.1. NM_001256673.1. [Q9UBI4-2]
NP_001243603.1. NM_001256674.1. [Q9UBI4-4]
NP_001243604.1. NM_001256675.1. [Q9UBI4-6]
NP_001243605.1. NM_001256676.1.
NP_001243606.1. NM_001256677.1. [Q9UBI4-5]
NP_004800.2. NM_004809.4. [Q9UBI4-1]
XP_006720836.1. XM_006720773.1. [Q9UBI4-5]
UniGeneiHs.194816.

Genome annotation databases

EnsembliENST00000316900; ENSP00000319323; ENSG00000067221. [Q9UBI4-5]
ENST00000316911; ENSP00000319384; ENSG00000067221. [Q9UBI4-2]
ENST00000359750; ENSP00000352788; ENSG00000067221. [Q9UBI4-6]
ENST00000541638; ENSP00000442478; ENSG00000067221. [Q9UBI4-1]
ENST00000564777; ENSP00000456343; ENSG00000067221. [Q9UBI4-4]
GeneIDi9399.
KEGGihsa:9399.
UCSCiuc002awe.4. human. [Q9UBI4-1]
uc002awh.4. human. [Q9UBI4-2]

Polymorphism databases

DMDMi60415942.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16522 mRNA. Translation: CAA76271.1. Frameshift.
AF156564
, AF156558, AF156560, AF156559, AF156563, AF156562, AF156561 Genomic DNA. Translation: AAF23080.1.
AF156557 mRNA. Translation: AAF06960.1.
AF111800 mRNA. Translation: AAL39002.1.
DQ064605 mRNA. Translation: AAY68393.1.
CR542089 mRNA. Translation: CAG46886.1.
AK300799 mRNA. Translation: BAG62457.1.
AK302051 mRNA. Translation: BAG63441.1.
AK075244 mRNA. Translation: BAG52092.1.
AC108137 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77940.1.
CH471082 Genomic DNA. Translation: EAW77944.1.
BC034379 mRNA. Translation: AAH34379.1.
BC065249 mRNA. Translation: AAH65249.1.
AF074953 mRNA. Translation: AAD42031.1. Frameshift.
AL109664 mRNA. Translation: CAB52015.1.
AL109665 mRNA. Translation: CAB52016.1.
CCDSiCCDS10254.1. [Q9UBI4-1]
CCDS58382.1. [Q9UBI4-5]
CCDS58383.1. [Q9UBI4-4]
CCDS58384.1. [Q9UBI4-2]
CCDS58385.1. [Q9UBI4-6]
RefSeqiNP_001243601.1. NM_001256672.1. [Q9UBI4-3]
NP_001243602.1. NM_001256673.1. [Q9UBI4-2]
NP_001243603.1. NM_001256674.1. [Q9UBI4-4]
NP_001243604.1. NM_001256675.1. [Q9UBI4-6]
NP_001243605.1. NM_001256676.1.
NP_001243606.1. NM_001256677.1. [Q9UBI4-5]
NP_004800.2. NM_004809.4. [Q9UBI4-1]
XP_006720836.1. XM_006720773.1. [Q9UBI4-5]
UniGeneiHs.194816.

3D structure databases

ProteinModelPortaliQ9UBI4.
SMRiQ9UBI4. Positions 117-217, 306-391.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114796. 8 interactions.
IntActiQ9UBI4. 3 interactions.

PTM databases

PhosphoSiteiQ9UBI4.

Polymorphism databases

DMDMi60415942.

Proteomic databases

MaxQBiQ9UBI4.
PaxDbiQ9UBI4.
PRIDEiQ9UBI4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316900; ENSP00000319323; ENSG00000067221. [Q9UBI4-5]
ENST00000316911; ENSP00000319384; ENSG00000067221. [Q9UBI4-2]
ENST00000359750; ENSP00000352788; ENSG00000067221. [Q9UBI4-6]
ENST00000541638; ENSP00000442478; ENSG00000067221. [Q9UBI4-1]
ENST00000564777; ENSP00000456343; ENSG00000067221. [Q9UBI4-4]
GeneIDi9399.
KEGGihsa:9399.
UCSCiuc002awe.4. human. [Q9UBI4-1]
uc002awh.4. human. [Q9UBI4-2]

Organism-specific databases

CTDi9399.
GeneCardsiGC15M074275.
HGNCiHGNC:14560. STOML1.
HPAiHPA042353.
MIMi608326. gene.
neXtProtiNX_Q9UBI4.
PharmGKBiPA37898.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0330.
GeneTreeiENSGT00550000074454.
HOGENOMiHOG000065698.
HOVERGENiHBG079220.
InParanoidiQ9UBI4.
OMAiPLREIQM.
OrthoDBiEOG7KSX8R.
PhylomeDBiQ9UBI4.
TreeFamiTF105750.

Miscellaneous databases

ChiTaRSiSTOML1. human.
GeneWikiiSTOML1.
GenomeRNAii9399.
NextBioi35207.
PROiQ9UBI4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9UBI4.
CleanExiHS_STOML1.
ExpressionAtlasiQ9UBI4. baseline and differential.
GenevestigatoriQ9UBI4.

Family and domain databases

Gene3Di3.30.1050.10. 1 hit.
InterProiIPR001107. Band_7.
IPR003033. SCP2_sterol-bd_dom.
IPR028517. SLP1.
IPR001972. Stomatin_fam.
[Graphical view]
PANTHERiPTHR10264. PTHR10264. 1 hit.
PTHR10264:SF70. PTHR10264:SF70. 1 hit.
PfamiPF01145. Band_7. 1 hit.
PF02036. SCP2. 1 hit.
[Graphical view]
PRINTSiPR00721. STOMATIN.
SMARTiSM00244. PHB. 1 hit.
[Graphical view]
SUPFAMiSSF55718. SSF55718. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning of hSLP-1, a novel human brain-specific member of the band 7/MEC-2 family similar to Caenorhabditis elegans UNC-24."
    Seidel G., Prohaska R.
    Gene 225:23-29(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain cortex.
  2. "A novel gene STORP (STOmatin-Related Protein) is localized 2 kb upstream of the promyelocytic gene on chromosome 15q22."
    Gilles F., Glenn M., Goy A., Remache Y., Zelenetz A.D.
    Eur. J. Haematol. 64:104-113(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Fetal liver.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Aorta.
  4. Li H., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Wen S., Lin L., Yang S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
  5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
    Tissue: Testis.
  7. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Thyroid.
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon and Lung.
  11. "UNC-24/hunc-24 implicates stomatin and stomatin-like proteins in the function of the lipid bilayer."
    Barnes T.M., Benard C., Hekimi S.
    Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-398 (ISOFORM 3).
  12. The European IMAGE consortium
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-398 (ISOFORM 4).

Entry informationi

Entry nameiSTML1_HUMAN
AccessioniPrimary (citable) accession number: Q9UBI4
Secondary accession number(s): B3KQN0
, B4DUU5, B4DXM9, E7ESC0, H3BRP3, O95675, Q4PNR4, Q6FGL8, Q8WYI7, Q9UMB9, Q9UMC0, Q9Y6H9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 31, 2005
Last sequence update: April 30, 2000
Last modified: March 31, 2015
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.