Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9UBI4

- STML1_HUMAN

UniProt

Q9UBI4 - STML1_HUMAN

Protein

Stomatin-like protein 1

Gene

STOML1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Stomatin-like protein 1
    Short name:
    SLP-1
    Alternative name(s):
    EPB72-like protein 1
    Protein unc-24 homolog
    Stomatin-related protein
    Short name:
    STORP
    Gene namesi
    Name:STOML1
    Synonyms:SLP1, UNC24
    ORF Names:MSTP019
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 15

    Organism-specific databases

    HGNCiHGNC:14560. STOML1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37898.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 398398Stomatin-like protein 1PRO_0000094029Add
    BLAST

    Proteomic databases

    MaxQBiQ9UBI4.
    PaxDbiQ9UBI4.
    PRIDEiQ9UBI4.

    PTM databases

    PhosphoSiteiQ9UBI4.

    Expressioni

    Tissue specificityi

    Ubiquitously expressed at low levels. Expression is highest in brain.2 Publications

    Gene expression databases

    ArrayExpressiQ9UBI4.
    BgeeiQ9UBI4.
    CleanExiHS_STOML1.
    GenevestigatoriQ9UBI4.

    Organism-specific databases

    HPAiHPA042353.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CDK2P249412EBI-2681162,EBI-375096
    FBXW7Q969H0-43EBI-2681162,EBI-6502391

    Protein-protein interaction databases

    BioGridi114796. 7 interactions.
    IntActiQ9UBI4. 3 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9UBI4.
    SMRiQ9UBI4. Positions 117-217, 306-391.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini79 – 398320CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei58 – 7821Helical; Signal-anchor for type III membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini287 – 398112SCP2Add
    BLAST

    Sequence similaritiesi

    Belongs to the band 7/mec-2 family.Curated
    Contains 1 SCP2 domain.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0330.
    HOVERGENiHBG079220.
    InParanoidiQ9UBI4.
    OMAiPSCLCHG.
    PhylomeDBiQ9UBI4.
    TreeFamiTF105750.

    Family and domain databases

    Gene3Di3.30.1050.10. 1 hit.
    InterProiIPR001107. Band_7.
    IPR003033. SCP2_sterol-bd_dom.
    IPR028517. SLP1.
    IPR001972. Stomatin_fam.
    [Graphical view]
    PANTHERiPTHR10264. PTHR10264. 1 hit.
    PTHR10264:SF70. PTHR10264:SF70. 1 hit.
    PfamiPF01145. Band_7. 1 hit.
    PF02036. SCP2. 1 hit.
    [Graphical view]
    PRINTSiPR00721. STOMATIN.
    SMARTiSM00244. PHB. 1 hit.
    [Graphical view]
    SUPFAMiSSF55718. SSF55718. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9UBI4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLGRSGYRAL PLGDFDRFQQ SSFGFLGSQK GCLSPERGGV GTGADVPQSW    50
    PSCLCHGLIS FLGFLLLLVT FPISGWFALK IVPTYERMIV FRLGRIRTPQ 100
    GPGMVLLLPF IDSFQRVDLR TRAFNVPPCK LASKDGAVLS VGADVQFRIW 150
    DPVLSVMTVK DLNTATRMTA QNAMTKALLK RPLREIQMEK LKISDQLLLE 200
    INDVTRAWGL EVDRVELAVE AVLQPPQDSP AGPNLDSTLQ QLALHFLGGS 250
    MNSMAGGAPS PGPADTVEMV SEVEPPAPQV GARSSPKQPL AEGLLTALQP 300
    FLSEALVSQV GACYQFNVVL PSGTQSAYFL DLTTGRGRVG HGVPDGIPDV 350
    VVEMAEADLR ALLCRELRPL GAYMSGRLKV KGDLAMAMKL EAVLRALK 398
    Length:398
    Mass (Da):42,968
    Last modified:May 1, 2000 - v1
    Checksum:iA9850C26394E1C3D
    GO
    Isoform 2 (identifier: Q9UBI4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-129: Missing.

    Show »
    Length:348
    Mass (Da):37,170
    Checksum:i436B02A898059006
    GO
    Isoform 3 (identifier: Q9UBI4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         264-264: Missing.

    Show »
    Length:397
    Mass (Da):42,897
    Checksum:iD88DFC8B3AB37397
    GO
    Isoform 4 (identifier: Q9UBI4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-129: Missing.
         264-264: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:347
    Mass (Da):37,099
    Checksum:i2683722A713F4830
    GO
    Isoform 5 (identifier: Q9UBI4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-44: MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGA → MP
         264-264: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:355
    Mass (Da):38,534
    Checksum:i59AB1BE8E1A34A9A
    GO
    Isoform 6 (identifier: Q9UBI4-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         264-264: Missing.
         265-334: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:327
    Mass (Da):35,520
    Checksum:i7910E73D608CEED9
    GO

    Sequence cautioni

    The sequence AAD42031.1 differs from that shown. Reason: Frameshift at positions 201 and 210.
    The sequence CAA76271.1 differs from that shown. Reason: Frameshift at positions 230, 233, 263, 292 and 300.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti50 – 501W → G in CAG46886. 1 PublicationCurated
    Sequence conflicti222 – 2221V → L in AAL39002. 1 PublicationCurated
    Sequence conflicti291 – 2911A → T in CAG46886. 1 PublicationCurated
    Sequence conflicti369 – 3691P → R in CAA76271. (PubMed:9931417)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4444MLGRS…VGTGA → MP in isoform 5. 1 PublicationVSP_054648Add
    BLAST
    Alternative sequencei80 – 12950Missing in isoform 2 and isoform 4. 3 PublicationsVSP_012654Add
    BLAST
    Alternative sequencei264 – 2641Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 4 PublicationsVSP_054649
    Alternative sequencei265 – 33470Missing in isoform 6. 1 PublicationVSP_054650Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y16522 mRNA. Translation: CAA76271.1. Frameshift.
    AF156564
    , AF156558, AF156560, AF156559, AF156563, AF156562, AF156561 Genomic DNA. Translation: AAF23080.1.
    AF156557 mRNA. Translation: AAF06960.1.
    AF111800 mRNA. Translation: AAL39002.1.
    DQ064605 mRNA. Translation: AAY68393.1.
    CR542089 mRNA. Translation: CAG46886.1.
    AK300799 mRNA. Translation: BAG62457.1.
    AK302051 mRNA. Translation: BAG63441.1.
    AK075244 mRNA. Translation: BAG52092.1.
    AC108137 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77940.1.
    CH471082 Genomic DNA. Translation: EAW77944.1.
    BC034379 mRNA. Translation: AAH34379.1.
    BC065249 mRNA. Translation: AAH65249.1.
    AF074953 mRNA. Translation: AAD42031.1. Frameshift.
    AL109664 mRNA. Translation: CAB52015.1.
    AL109665 mRNA. Translation: CAB52016.1.
    CCDSiCCDS10254.1. [Q9UBI4-1]
    CCDS58382.1. [Q9UBI4-5]
    CCDS58383.1. [Q9UBI4-4]
    CCDS58384.1. [Q9UBI4-2]
    CCDS58385.1. [Q9UBI4-6]
    RefSeqiNP_001243601.1. NM_001256672.1. [Q9UBI4-3]
    NP_001243602.1. NM_001256673.1. [Q9UBI4-2]
    NP_001243603.1. NM_001256674.1. [Q9UBI4-4]
    NP_001243604.1. NM_001256675.1. [Q9UBI4-6]
    NP_001243605.1. NM_001256676.1.
    NP_001243606.1. NM_001256677.1. [Q9UBI4-5]
    NP_004800.2. NM_004809.4. [Q9UBI4-1]
    XP_006720836.1. XM_006720773.1. [Q9UBI4-5]
    UniGeneiHs.194816.

    Genome annotation databases

    EnsembliENST00000316900; ENSP00000319323; ENSG00000067221. [Q9UBI4-1]
    ENST00000316911; ENSP00000319384; ENSG00000067221. [Q9UBI4-2]
    ENST00000359750; ENSP00000352788; ENSG00000067221. [Q9UBI4-6]
    ENST00000541638; ENSP00000442478; ENSG00000067221. [Q9UBI4-5]
    ENST00000564777; ENSP00000456343; ENSG00000067221. [Q9UBI4-4]
    GeneIDi9399.
    KEGGihsa:9399.
    UCSCiuc002awe.4. human. [Q9UBI4-1]
    uc002awh.4. human. [Q9UBI4-2]

    Polymorphism databases

    DMDMi60415942.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y16522 mRNA. Translation: CAA76271.1 . Frameshift.
    AF156564
    , AF156558 , AF156560 , AF156559 , AF156563 , AF156562 , AF156561 Genomic DNA. Translation: AAF23080.1 .
    AF156557 mRNA. Translation: AAF06960.1 .
    AF111800 mRNA. Translation: AAL39002.1 .
    DQ064605 mRNA. Translation: AAY68393.1 .
    CR542089 mRNA. Translation: CAG46886.1 .
    AK300799 mRNA. Translation: BAG62457.1 .
    AK302051 mRNA. Translation: BAG63441.1 .
    AK075244 mRNA. Translation: BAG52092.1 .
    AC108137 Genomic DNA. No translation available.
    CH471082 Genomic DNA. Translation: EAW77940.1 .
    CH471082 Genomic DNA. Translation: EAW77944.1 .
    BC034379 mRNA. Translation: AAH34379.1 .
    BC065249 mRNA. Translation: AAH65249.1 .
    AF074953 mRNA. Translation: AAD42031.1 . Frameshift.
    AL109664 mRNA. Translation: CAB52015.1 .
    AL109665 mRNA. Translation: CAB52016.1 .
    CCDSi CCDS10254.1. [Q9UBI4-1 ]
    CCDS58382.1. [Q9UBI4-5 ]
    CCDS58383.1. [Q9UBI4-4 ]
    CCDS58384.1. [Q9UBI4-2 ]
    CCDS58385.1. [Q9UBI4-6 ]
    RefSeqi NP_001243601.1. NM_001256672.1. [Q9UBI4-3 ]
    NP_001243602.1. NM_001256673.1. [Q9UBI4-2 ]
    NP_001243603.1. NM_001256674.1. [Q9UBI4-4 ]
    NP_001243604.1. NM_001256675.1. [Q9UBI4-6 ]
    NP_001243605.1. NM_001256676.1.
    NP_001243606.1. NM_001256677.1. [Q9UBI4-5 ]
    NP_004800.2. NM_004809.4. [Q9UBI4-1 ]
    XP_006720836.1. XM_006720773.1. [Q9UBI4-5 ]
    UniGenei Hs.194816.

    3D structure databases

    ProteinModelPortali Q9UBI4.
    SMRi Q9UBI4. Positions 117-217, 306-391.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114796. 7 interactions.
    IntActi Q9UBI4. 3 interactions.

    PTM databases

    PhosphoSitei Q9UBI4.

    Polymorphism databases

    DMDMi 60415942.

    Proteomic databases

    MaxQBi Q9UBI4.
    PaxDbi Q9UBI4.
    PRIDEi Q9UBI4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000316900 ; ENSP00000319323 ; ENSG00000067221 . [Q9UBI4-1 ]
    ENST00000316911 ; ENSP00000319384 ; ENSG00000067221 . [Q9UBI4-2 ]
    ENST00000359750 ; ENSP00000352788 ; ENSG00000067221 . [Q9UBI4-6 ]
    ENST00000541638 ; ENSP00000442478 ; ENSG00000067221 . [Q9UBI4-5 ]
    ENST00000564777 ; ENSP00000456343 ; ENSG00000067221 . [Q9UBI4-4 ]
    GeneIDi 9399.
    KEGGi hsa:9399.
    UCSCi uc002awe.4. human. [Q9UBI4-1 ]
    uc002awh.4. human. [Q9UBI4-2 ]

    Organism-specific databases

    CTDi 9399.
    GeneCardsi GC15M074275.
    HGNCi HGNC:14560. STOML1.
    HPAi HPA042353.
    MIMi 608326. gene.
    neXtProti NX_Q9UBI4.
    PharmGKBi PA37898.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0330.
    HOVERGENi HBG079220.
    InParanoidi Q9UBI4.
    OMAi PSCLCHG.
    PhylomeDBi Q9UBI4.
    TreeFami TF105750.

    Miscellaneous databases

    ChiTaRSi STOML1. human.
    GeneWikii STOML1.
    GenomeRNAii 9399.
    NextBioi 35207.
    PROi Q9UBI4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9UBI4.
    Bgeei Q9UBI4.
    CleanExi HS_STOML1.
    Genevestigatori Q9UBI4.

    Family and domain databases

    Gene3Di 3.30.1050.10. 1 hit.
    InterProi IPR001107. Band_7.
    IPR003033. SCP2_sterol-bd_dom.
    IPR028517. SLP1.
    IPR001972. Stomatin_fam.
    [Graphical view ]
    PANTHERi PTHR10264. PTHR10264. 1 hit.
    PTHR10264:SF70. PTHR10264:SF70. 1 hit.
    Pfami PF01145. Band_7. 1 hit.
    PF02036. SCP2. 1 hit.
    [Graphical view ]
    PRINTSi PR00721. STOMATIN.
    SMARTi SM00244. PHB. 1 hit.
    [Graphical view ]
    SUPFAMi SSF55718. SSF55718. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning of hSLP-1, a novel human brain-specific member of the band 7/MEC-2 family similar to Caenorhabditis elegans UNC-24."
      Seidel G., Prohaska R.
      Gene 225:23-29(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Brain cortex.
    2. "A novel gene STORP (STOmatin-Related Protein) is localized 2 kb upstream of the promyelocytic gene on chromosome 15q22."
      Gilles F., Glenn M., Goy A., Remache Y., Zelenetz A.D.
      Eur. J. Haematol. 64:104-113(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Fetal liver.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Aorta.
    4. Li H., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Wen S., Lin L., Yang S.
      Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
    5. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
      Tissue: Testis.
    7. "Analysis of the DNA sequence and duplication history of human chromosome 15."
      Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
      , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
      Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Thyroid.
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon and Lung.
    11. "UNC-24/hunc-24 implicates stomatin and stomatin-like proteins in the function of the lipid bilayer."
      Barnes T.M., Benard C., Hekimi S.
      Submitted (JUN-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-398 (ISOFORM 3).
    12. The European IMAGE consortium
      Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-398 (ISOFORM 4).

    Entry informationi

    Entry nameiSTML1_HUMAN
    AccessioniPrimary (citable) accession number: Q9UBI4
    Secondary accession number(s): B3KQN0
    , B4DUU5, B4DXM9, E7ESC0, H3BRP3, O95675, Q4PNR4, Q6FGL8, Q8WYI7, Q9UMB9, Q9UMC0, Q9Y6H9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 2005
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 15
      Human chromosome 15: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3