Q9UBF6 (RBX2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RING-box protein 2 Short name=Rbx2 Alternative name(s): CKII beta-binding protein 1 Short name=CKBBP1 RING finger protein 7 Regulator of cullins 2 Sensitive to apoptosis gene protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 113 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents. Ref.10 |
| Pathway | |
| Subunit structure | Probable part of SCF complexes, which consist of SKP1, CUL1, RNF7/RBX2 and a F-box protein. Interacts (preferentially) with CUL5. Also interacts (with lower preference) with CUL1, CUL2, CUL3, CUL4A and CUL4B. Interacts with UBE2F. Interacts with CSNK2B, the interaction is not affected by phosphorylation by CK2. Ref.2 Ref.10 Ref.12 |
| Subcellular location | |
| Tissue specificity | Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung. Ref.1 |
| Induction | By 1,10-phenanthroline. Ref.3 |
| Domain | The RING-type zinc finger domain is essential for ubiquitin ligase activity. It coordinates an additional third zinc ion. |
| Post-translational modification | Phosphorylation by CK2 is required for efficient degradation of NFKBIA and CDKN1B. |
| Sequence similarities | Belongs to the RING-box family. Contains 1 RING-type zinc finger. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| IKBKG | Q9Y6K9 | 3 | EBI-398632,EBI-81279 | |
| vif | P12504 | 4 | EBI-398632,EBI-779991 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9UBF6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9UBF6-2) Also known as: SAG-v; The sequence of this isoform differs from the canonical sequence as follows: 60-113: ACLRCQAENK...QDWVVQRIGK → EGIGVRNWSE...SHQPCLDDHR | ||||||
| Note: Inactive. | ||||||
| Isoform 3 (identifier: Q9UBF6-3) The sequence of this isoform differs from the canonical sequence as follows: 57-113: VMDACLRCQA...QDWVVQRIGK → MPVLDVKLKTNKRTVLWSGENVIIPSTTAACPCG | ||||||
| Isoform 4 (identifier: Q9UBF6-4) The sequence of this isoform differs from the canonical sequence as follows: 59-74: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 113 | 113 | RING-box protein 2 | PRO_0000056023 | |||||||||||||||||||||
Regions | |||||||||||||||||||||||||
| Zinc finger | 61 – 103 | 43 | RING-type | ||||||||||||||||||||||
Sites | |||||||||||||||||||||||||
| Metal binding | 50 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||
| Metal binding | 53 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||
| Metal binding | 61 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||
| Metal binding | 64 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||
| Metal binding | 73 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||
| Metal binding | 80 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||
| Metal binding | 82 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||
| Metal binding | 85 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||
| Metal binding | 87 | 1 | Zinc 3 By similarity | ||||||||||||||||||||||
| Metal binding | 88 | 1 | Zinc 1 By similarity | ||||||||||||||||||||||
| Metal binding | 99 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||
| Metal binding | 102 | 1 | Zinc 2 By similarity | ||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||
| Modified residue | 10 | 1 | Phosphothreonine; by CK2 Ref.11 | ||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||
| Alternative sequence | 57 – 113 | 57 | VMDAC…QRIGK → MPVLDVKLKTNKRTVLWSGE NVIIPSTTAACPCG in isoform 3. | VSP_041444 | |||||||||||||||||||||
| Alternative sequence | 59 – 74 | 16 | Missing in isoform 4. | VSP_044525 | |||||||||||||||||||||
| Alternative sequence | 60 – 113 | 54 | ACLRC…QRIGK → EGIGVRNWSEALNLINASEM GFDCRSGSTALAVPSVSLAS HQPCLDDHR in isoform 2. | VSP_008449 | |||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||
| Sequence conflict | 23 | 1 | K → T in AAD30147. Ref.2 | ||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||
| Turn | 51 – 54 | 4 | |||||||||||||||||||||||
| Helix | 64 – 67 | 4 | |||||||||||||||||||||||
| Turn | 70 – 72 | 3 | |||||||||||||||||||||||
| Beta strand | 75 – 78 | 4 | |||||||||||||||||||||||
| Beta strand | 83 – 85 | 3 | |||||||||||||||||||||||
| Helix | 86 – 92 | 7 | |||||||||||||||||||||||
| Turn | 93 – 95 | 3 | |||||||||||||||||||||||
| Turn | 100 – 102 | 3 | |||||||||||||||||||||||
| Beta strand | 108 – 112 | 5 | |||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif." Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S. Biochem. Biophys. Res. Commun. 263:743-748(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "ROC1, a homolog of APC11, represents a family of cullin partners with an associated ubiquitin ligase activity." Ohta T., Michel J.J., Schottelius A.J., Xiong Y. Mol. Cell 3:535-541(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH CULLINS. |
| [3] | "SAG, a novel zinc RING finger protein that protects cells from apoptosis induced by redox agents." Duan H., Wang Y., Aviram M., Swaroop M., Loo J.A., Bian J., Tian Y., Mueller T., Bisgaier C.L., Sun Y. Mol. Cell. Biol. 19:3145-3155(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, SUBCELLULAR LOCATION. |
| [4] | "SAG/ROC2/Rbx2/Hrt2, a component of SCF E3 ubiquitin ligase: genomic structure, a splicing variant, and two family pseudogenes." Swaroop M., Gosink M., Sun Y. DNA Cell Biol. 20:425-434(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Corpus callosum and Uterus. |
| [7] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain and Kidney. |
| [10] | "Yeast homolog of human SAG/ROC2/Rbx2/Hrt2 is essential for cell growth, but not for germination: chip profiling implicates its role in cell cycle regulation." Swaroop M., Wang Y., Miller P., Duan H., Jatkoe T., Madore S.J., Sun Y. Oncogene 19:2855-2866(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CUL1, FUNCTION. |
| [11] | "Phosphorylation of threonine 10 on CKBBP1/SAG/ROC2/Rbx2 by protein kinase CKII promotes the degradation of IkappaBalpha and p27Kip1." Kim Y.-S., Lee J.-Y., Son M.-Y., Park W., Bae Y.-S. J. Biol. Chem. 278:28462-28469(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT THR-10 BY CK2. |
| [12] | "E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification." Huang D.T., Ayrault O., Hunt H.W., Taherbhoy A.M., Duda D.M., Scott D.C., Borg L.A., Neale G., Murray P.J., Roussel M.F., Schulman B.A. Mol. Cell 33:483-495(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH UBE2F. |
| [13] | "Solution structure of the RING domain of the human RING-box protein 2." RIKEN structural genomics initiative (RSGI) Submitted (AUG-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 40-113. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF164679 mRNA. Translation: AAD55984.1. AF142060 mRNA. Translation: AAD30147.1. AF092878 mRNA. Translation: AAD25962.1. AF312226 mRNA. Translation: AAK37450.1. BT007348 mRNA. Translation: AAP36012.1. AK289894 mRNA. Translation: BAF82583.1. DB272382 mRNA. No translation available. AC112771 Genomic DNA. No translation available. CH471052 Genomic DNA. Translation: EAW78991.1. CH471052 Genomic DNA. Translation: EAW78992.1. CH471052 Genomic DNA. Translation: EAW78994.1. CH471052 Genomic DNA. Translation: EAW78995.1. CH471052 Genomic DNA. Translation: EAW78996.1. BC005966 mRNA. Translation: AAH05966.1. BC008627 mRNA. Translation: AAH08627.1. | ||||||||||||
| IPI | IPI00030891. IPI00033132. IPI00377253. IPI00945636. | ||||||||||||
| RefSeq | NP_001188299.1. NM_001201370.1. NP_055060.1. NM_014245.4. NP_899060.1. NM_183237.2. | ||||||||||||
| UniGene | Hs.134623. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9UBF6. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9UBF6. 22 interactions. | ||||||||||||
| MINT | MINT-1470812. | ||||||||||||
| STRING | 9606.ENSP00000273480. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9UBF6. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 37538003. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9UBF6. | ||||||||||||
| PRIDE | Q9UBF6. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 9616. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000273480; ENSP00000273480; ENSG00000114125. ENST00000393000; ENSP00000376725; ENSG00000114125. ENST00000477012; ENSP00000419339; ENSG00000114125. ENST00000480908; ENSP00000419084; ENSG00000114125. | ||||||||||||
| GeneID | 9616. | ||||||||||||
| KEGG | hsa:9616. | ||||||||||||
| UCSC | uc003euc.3. human. uc003eud.3. human. uc021xeu.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 9616. | ||||||||||||
| GeneCards | GC03P141457. | ||||||||||||
| HGNC | HGNC:10070. RNF7. | ||||||||||||
| HPA | HPA036995. | ||||||||||||
| MIM | 603863. gene. | ||||||||||||
| neXtProt | NX_Q9UBF6. | ||||||||||||
| PharmGKB | PA34444. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5194. | ||||||||||||
| HOVERGEN | HBG001507. | ||||||||||||
| InParanoid | Q9UBF6. | ||||||||||||
| KO | K10611. | ||||||||||||
| OMA | DICAICR. | ||||||||||||
| OrthoDB | EOG42BX9Z. | ||||||||||||
| PhylomeDB | Q9UBF6. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| UniPathway | UPA00143. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9UBF6. | ||||||||||||
| Bgee | Q9UBF6. | ||||||||||||
| CleanEx | HS_RNF7. HS_SAG. | ||||||||||||
| Genevestigator | Q9UBF6. | ||||||||||||
| GermOnline | ENSG00000114125. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.40.10. 1 hit. | ||||||||||||
| InterPro | IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR024766. Znf_RING_H2. [Graphical view] | ||||||||||||
| Pfam | PF12678. zf-rbx1. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00184. RING. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9UBF6. | ||||||||||||
| GenomeRNAi | 9616. | ||||||||||||
| NextBio | 36073. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RBX2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9UBF6 Secondary accession number(s): A8K1H9 Q9Y5M7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
