Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RING-box protein 2

Gene

RNF7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription (PubMed:10851089). CRLs complexes and ARIH1 collaborate in tandem to mediate ubiquitination of target proteins, ARIH1 mediating addition of the first ubiquitin on CRLs targets (By similarity). Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.By similarity1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi50Zinc 1By similarity1
Metal bindingi53Zinc 1By similarity1
Metal bindingi61Zinc 3By similarity1
Metal bindingi64Zinc 3By similarity1
Metal bindingi73Zinc 3By similarity1
Metal bindingi80Zinc 2By similarity1
Metal bindingi82Zinc 2By similarity1
Metal bindingi85Zinc 1By similarity1
Metal bindingi87Zinc 3By similarity1
Metal bindingi88Zinc 1By similarity1
Metal bindingi99Zinc 2By similarity1
Metal bindingi102Zinc 2By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri61 – 103RING-typePROSITE-ProRule annotationAdd BLAST43

GO - Molecular functioni

  • copper ion binding Source: ProtInc
  • cullin family protein binding Source: MGI
  • NEDD8 transferase activity Source: UniProtKB
  • ubiquitin protein ligase activity Source: GO_Central
  • zinc ion binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SIGNORiQ9UBF6.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
RING-box protein 2
Short name:
Rbx2
Alternative name(s):
CKII beta-binding protein 1
Short name:
CKBBP1
RING finger protein 7
Regulator of cullins 2
Sensitive to apoptosis gene protein
Gene namesi
Name:RNF7
Synonyms:RBX2, ROC2, SAG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:10070. RNF7.

Subcellular locationi

GO - Cellular componenti

  • Cul2-RING ubiquitin ligase complex Source: GO_Central
  • Cul3-RING ubiquitin ligase complex Source: GO_Central
  • Cul4-RING E3 ubiquitin ligase complex Source: GO_Central
  • Cul5-RING ubiquitin ligase complex Source: MGI
  • Cul7-RING ubiquitin ligase complex Source: GO_Central
  • cytoplasm Source: UniProtKB
  • nuclear SCF ubiquitin ligase complex Source: GO_Central
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi9616.
OpenTargetsiENSG00000114125.
PharmGKBiPA34444.

Polymorphism and mutation databases

BioMutaiRNF7.
DMDMi37538003.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000560232 – 113RING-box protein 2Add BLAST112

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei10Phosphothreonine; by CK21 Publication1

Post-translational modificationi

Phosphorylation by CK2 is required for efficient degradation of NFKBIA and CDKN1B.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9UBF6.
MaxQBiQ9UBF6.
PaxDbiQ9UBF6.
PeptideAtlasiQ9UBF6.
PRIDEiQ9UBF6.

PTM databases

iPTMnetiQ9UBF6.
PhosphoSitePlusiQ9UBF6.

Expressioni

Tissue specificityi

Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung.1 Publication

Inductioni

By 1,10-phenanthroline.1 Publication

Gene expression databases

BgeeiENSG00000114125.
CleanExiHS_RNF7.
HS_SAG.
ExpressionAtlasiQ9UBF6. baseline and differential.
GenevisibleiQ9UBF6. HS.

Organism-specific databases

HPAiHPA036995.

Interactioni

Subunit structurei

Probable part of SCF complexes, which consist of SKP1, CUL1, RNF7/RBX2 and a F-box protein. Interacts (preferentially) with CUL5. Also interacts (with lower preference) with CUL1, CUL2, CUL3, CUL4A and CUL4B. Interacts with UBE2F. Interacts with CSNK2B, the interaction is not affected by phosphorylation by CK2.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ASB2Q96Q272EBI-398632,EBI-2880677
CUL5Q930346EBI-398632,EBI-1057139
IKBKGQ9Y6K93EBI-398632,EBI-81279
vifP125044EBI-398632,EBI-779991From a different organism.

GO - Molecular functioni

  • cullin family protein binding Source: MGI

Protein-protein interaction databases

BioGridi114977. 61 interactors.
IntActiQ9UBF6. 28 interactors.
MINTiMINT-1470812.
STRINGi9606.ENSP00000273480.

Structurei

Secondary structure

1113
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni51 – 54Combined sources4
Helixi64 – 67Combined sources4
Turni70 – 72Combined sources3
Beta strandi75 – 78Combined sources4
Beta strandi83 – 85Combined sources3
Helixi86 – 92Combined sources7
Turni93 – 95Combined sources3
Turni100 – 102Combined sources3
Beta strandi108 – 112Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ECLNMR-A40-113[»]
ProteinModelPortaliQ9UBF6.
SMRiQ9UBF6.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9UBF6.

Family & Domainsi

Domaini

The RING-type zinc finger domain is essential for ubiquitin ligase activity. It coordinates an additional third zinc ion.

Sequence similaritiesi

Belongs to the RING-box family.Curated
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri61 – 103RING-typePROSITE-ProRule annotationAdd BLAST43

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG2930. Eukaryota.
COG5194. LUCA.
GeneTreeiENSGT00390000017058.
HOGENOMiHOG000171951.
HOVERGENiHBG001507.
InParanoidiQ9UBF6.
KOiK10611.
OMAiWIVQRIG.
OrthoDBiEOG091G0TA5.
PhylomeDBiQ9UBF6.
TreeFamiTF351049.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR024766. Znf_RING_H2.
[Graphical view]
PfamiPF12678. zf-rbx1. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBF6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADVEDGEET CALASHSGSS GSKSGGDKMF SLKKWNAVAM WSWDVECDTC
60 70 80 90 100
AICRVQVMDA CLRCQAENKQ EDCVVVWGEC NHSFHNCCMS LWVKQNNRCP
110
LCQQDWVVQR IGK
Length:113
Mass (Da):12,683
Last modified:May 1, 2000 - v1
Checksum:iCE1E6CAC940C8257
GO
Isoform 2 (identifier: Q9UBF6-2) [UniParc]FASTAAdd to basket
Also known as: SAG-v

The sequence of this isoform differs from the canonical sequence as follows:
     60-113: ACLRCQAENK...QDWVVQRIGK → EGIGVRNWSE...SHQPCLDDHR

Note: Inactive.
Show »
Length:108
Mass (Da):11,557
Checksum:i77A887E012AEE520
GO
Isoform 3 (identifier: Q9UBF6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     57-113: VMDACLRCQA...QDWVVQRIGK → MPVLDVKLKTNKRTVLWSGENVIIPSTTAACPCG

Show »
Length:90
Mass (Da):9,642
Checksum:iE26F96D19B016540
GO
Isoform 4 (identifier: Q9UBF6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     59-74: Missing.

Note: No experimental confirmation available.
Show »
Length:97
Mass (Da):10,876
Checksum:i5277FEE26DCEB81F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti23K → T in AAD30147 (PubMed:10230407).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04144457 – 113VMDAC…QRIGK → MPVLDVKLKTNKRTVLWSGE NVIIPSTTAACPCG in isoform 3. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_04452559 – 74Missing in isoform 4. CuratedAdd BLAST16
Alternative sequenceiVSP_00844960 – 113ACLRC…QRIGK → EGIGVRNWSEALNLINASEM GFDCRSGSTALAVPSVSLAS HQPCLDDHR in isoform 2. 2 PublicationsAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF164679 mRNA. Translation: AAD55984.1.
AF142060 mRNA. Translation: AAD30147.1.
AF092878 mRNA. Translation: AAD25962.1.
AF312226 mRNA. Translation: AAK37450.1.
BT007348 mRNA. Translation: AAP36012.1.
AK289894 mRNA. Translation: BAF82583.1.
DB272382 mRNA. No translation available.
AC112771 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78991.1.
CH471052 Genomic DNA. Translation: EAW78992.1.
CH471052 Genomic DNA. Translation: EAW78994.1.
CH471052 Genomic DNA. Translation: EAW78995.1.
CH471052 Genomic DNA. Translation: EAW78996.1.
BC005966 mRNA. Translation: AAH05966.1.
BC008627 mRNA. Translation: AAH08627.1.
CCDSiCCDS3118.1. [Q9UBF6-1]
CCDS43158.1. [Q9UBF6-3]
CCDS56283.1. [Q9UBF6-4]
RefSeqiNP_001188299.1. NM_001201370.1. [Q9UBF6-4]
NP_055060.1. NM_014245.4. [Q9UBF6-1]
NP_899060.1. NM_183237.2. [Q9UBF6-3]
UniGeneiHs.134623.

Genome annotation databases

EnsembliENST00000273480; ENSP00000273480; ENSG00000114125. [Q9UBF6-1]
ENST00000393000; ENSP00000376725; ENSG00000114125. [Q9UBF6-3]
ENST00000477012; ENSP00000419339; ENSG00000114125. [Q9UBF6-2]
ENST00000480908; ENSP00000419084; ENSG00000114125. [Q9UBF6-4]
GeneIDi9616.
KEGGihsa:9616.
UCSCiuc003euc.4. human. [Q9UBF6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF164679 mRNA. Translation: AAD55984.1.
AF142060 mRNA. Translation: AAD30147.1.
AF092878 mRNA. Translation: AAD25962.1.
AF312226 mRNA. Translation: AAK37450.1.
BT007348 mRNA. Translation: AAP36012.1.
AK289894 mRNA. Translation: BAF82583.1.
DB272382 mRNA. No translation available.
AC112771 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW78991.1.
CH471052 Genomic DNA. Translation: EAW78992.1.
CH471052 Genomic DNA. Translation: EAW78994.1.
CH471052 Genomic DNA. Translation: EAW78995.1.
CH471052 Genomic DNA. Translation: EAW78996.1.
BC005966 mRNA. Translation: AAH05966.1.
BC008627 mRNA. Translation: AAH08627.1.
CCDSiCCDS3118.1. [Q9UBF6-1]
CCDS43158.1. [Q9UBF6-3]
CCDS56283.1. [Q9UBF6-4]
RefSeqiNP_001188299.1. NM_001201370.1. [Q9UBF6-4]
NP_055060.1. NM_014245.4. [Q9UBF6-1]
NP_899060.1. NM_183237.2. [Q9UBF6-3]
UniGeneiHs.134623.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ECLNMR-A40-113[»]
ProteinModelPortaliQ9UBF6.
SMRiQ9UBF6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114977. 61 interactors.
IntActiQ9UBF6. 28 interactors.
MINTiMINT-1470812.
STRINGi9606.ENSP00000273480.

PTM databases

iPTMnetiQ9UBF6.
PhosphoSitePlusiQ9UBF6.

Polymorphism and mutation databases

BioMutaiRNF7.
DMDMi37538003.

Proteomic databases

EPDiQ9UBF6.
MaxQBiQ9UBF6.
PaxDbiQ9UBF6.
PeptideAtlasiQ9UBF6.
PRIDEiQ9UBF6.

Protocols and materials databases

DNASUi9616.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000273480; ENSP00000273480; ENSG00000114125. [Q9UBF6-1]
ENST00000393000; ENSP00000376725; ENSG00000114125. [Q9UBF6-3]
ENST00000477012; ENSP00000419339; ENSG00000114125. [Q9UBF6-2]
ENST00000480908; ENSP00000419084; ENSG00000114125. [Q9UBF6-4]
GeneIDi9616.
KEGGihsa:9616.
UCSCiuc003euc.4. human. [Q9UBF6-1]

Organism-specific databases

CTDi9616.
DisGeNETi9616.
GeneCardsiRNF7.
HGNCiHGNC:10070. RNF7.
HPAiHPA036995.
MIMi603863. gene.
neXtProtiNX_Q9UBF6.
OpenTargetsiENSG00000114125.
PharmGKBiPA34444.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2930. Eukaryota.
COG5194. LUCA.
GeneTreeiENSGT00390000017058.
HOGENOMiHOG000171951.
HOVERGENiHBG001507.
InParanoidiQ9UBF6.
KOiK10611.
OMAiWIVQRIG.
OrthoDBiEOG091G0TA5.
PhylomeDBiQ9UBF6.
TreeFamiTF351049.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
SIGNORiQ9UBF6.

Miscellaneous databases

ChiTaRSiRNF7. human.
EvolutionaryTraceiQ9UBF6.
GeneWikiiRNF7.
GenomeRNAii9616.
PROiQ9UBF6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114125.
CleanExiHS_RNF7.
HS_SAG.
ExpressionAtlasiQ9UBF6. baseline and differential.
GenevisibleiQ9UBF6. HS.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR024766. Znf_RING_H2.
[Graphical view]
PfamiPF12678. zf-rbx1. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRBX2_HUMAN
AccessioniPrimary (citable) accession number: Q9UBF6
Secondary accession number(s): A8K1H9
, A8MTB5, C9JYL3, D3DNF7, D3DNF8, Q9BXN8, Q9Y5M7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 3, 2003
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.