Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Epidermal growth factor receptor substrate 15-like 1

Gene

EPS15L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Seems to be a constitutive component of clathrin-coated pits that is required for receptor-mediated endocytosis. Involved in endocytosis of integrin beta-1 (ITGB1) and transferrin receptor (TFR); internalization of ITGB1 as DAB2-dependent cargo but not TFR seems to require association with DAB2.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi172 – 18413PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Endocytosis

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_12484. EGFR downregulation.

Names & Taxonomyi

Protein namesi
Recommended name:
Epidermal growth factor receptor substrate 15-like 1
Alternative name(s):
Eps15-related protein
Short name:
Eps15R
Gene namesi
Name:EPS15L1
Synonyms:EPS15R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:24634. EPS15L1.

Subcellular locationi

GO - Cellular componenti

  • clathrin coat of coated pit Source: Ensembl
  • membrane Source: UniProtKB
  • nucleus Source: UniProtKB-SubCell
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Coated pit, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134906266.

Polymorphism and mutation databases

BioMutaiEPS15L1.
DMDMi61223942.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 864863Epidermal growth factor receptor substrate 15-like 1PRO_0000146118Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication
Modified residuei74 – 741PhosphotyrosineBy similarity
Modified residuei108 – 1081PhosphoserineBy similarity
Modified residuei229 – 2291Phosphoserine2 Publications
Modified residuei244 – 2441Phosphoserine1 Publication
Modified residuei255 – 2551Phosphoserine4 Publications
Modified residuei366 – 3661Phosphothreonine1 Publication
Modified residuei371 – 3711Phosphoserine1 Publication
Modified residuei377 – 3771Phosphoserine1 Publication
Modified residuei560 – 5601Phosphoserine1 Publication
Modified residuei564 – 5641PhosphotyrosineBy similarity
Modified residuei577 – 5771Phosphothreonine1 Publication
Modified residuei593 – 5931Phosphoserine1 Publication
Modified residuei666 – 6661Phosphoserine1 Publication
Modified residuei734 – 7341Phosphoserine1 Publication
Modified residuei793 – 7931Phosphoserine1 Publication
Modified residuei797 – 7971Phosphothreonine1 Publication

Post-translational modificationi

Phosphorylated on tyrosine residues by EGFR.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9UBC2.
PaxDbiQ9UBC2.
PRIDEiQ9UBC2.

Expressioni

Gene expression databases

BgeeiQ9UBC2.
CleanExiHS_EPS15L1.
ExpressionAtlasiQ9UBC2. baseline and differential.
GenevisibleiQ9UBC2. HS.

Organism-specific databases

HPAiHPA019237.
HPA055309.

Interactioni

Subunit structurei

Interacts with EPS15, AGFG1/HRB and AGFG2/HRBL. Associates with the clathrin-associated adapter protein complex 2 (AP-2) (By similarity). Interacts with FCHO1. Interacts with FCHO2. Interacts (via EH domains) with DAB2. Interacts with UBQLN1 (via ubiquitin-like domain).By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
GNG5P632183EBI-2556746,EBI-10220734
PRKCDBPQ969G52EBI-2556746,EBI-3893101
TRAPPC2P0DI813EBI-2556746,EBI-5663373

Protein-protein interaction databases

BioGridi121840. 22 interactions.
IntActiQ9UBC2. 14 interactions.
MINTiMINT-1538779.
STRINGi9606.ENSP00000248070.

Structurei

3D structure databases

ProteinModelPortaliQ9UBC2.
SMRiQ9UBC2. Positions 11-105, 121-214, 269-362.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 10490EH 1PROSITE-ProRule annotationAdd
BLAST
Domaini127 – 21589EH 2PROSITE-ProRule annotationAdd
BLAST
Domaini159 – 19436EF-handPROSITE-ProRule annotationAdd
BLAST
Domaini275 – 36591EH 3PROSITE-ProRule annotationAdd
BLAST
Repeati618 – 62031
Repeati640 – 64232
Repeati645 – 64733
Repeati650 – 65234
Repeati656 – 65835
Repeati661 – 66336
Repeati667 – 66937
Repeati685 – 68738
Repeati690 – 69239
Repeati709 – 711310
Repeati728 – 730311
Repeati754 – 756312
Repeati806 – 808313
Repeati812 – 814314
Repeati833 – 835315

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni15 – 368354Interaction with DAB2By similarityAdd
BLAST
Regioni618 – 83521815 X 3 AA repeats of D-P-FAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi750 – 81667Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 EF-hand domain.PROSITE-ProRule annotation
Contains 3 EH domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiNOG301764.
GeneTreeiENSGT00760000118985.
HOGENOMiHOG000004804.
HOVERGENiHBG005591.
InParanoidiQ9UBC2.
OMAiSQMSKPP.
OrthoDBiEOG7JHM68.
PhylomeDBiQ9UBC2.
TreeFamiTF324293.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR000261. EPS15_homology.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
SM00027. EH. 3 hits.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 4 hits.
PS50031. EH. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9UBC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPLIPLSQ QIPTGNSLYE SYYKQVDPAY TGRVGASEAA LFLKKSGLSD
60 70 80 90 100
IILGKIWDLA DPEGKGFLDK QGFYVALRLV ACAQSGHEVT LSNLNLSMPP
110 120 130 140 150
PKFHDTSSPL MVTPPSAEAH WAVRVEEKAK FDGIFESLLP INGLLSGDKV
160 170 180 190 200
KPVLMNSKLP LDVLGRVWDL SDIDKDGHLD RDEFAVAMHL VYRALEKEPV
210 220 230 240 250
PSALPPSLIP PSKRKKTVFP GAVPVLPASP PPKDSLRSTP SHGSVSSLNS
260 270 280 290 300
TGSLSPKHSL KQTQPTVNWV VPVADKMRFD EIFLKTDLDL DGYVSGQEVK
310 320 330 340 350
EIFMHSGLTQ NLLAHIWALA DTRQTGKLSK DQFALAMYFI QQKVSKGIDP
360 370 380 390 400
PQVLSPDMVP PSERGTPGPD SSGSLGSGEF TGVKELDDIS QEIAQLQREK
410 420 430 440 450
YSLEQDIREK EEAIRQKTSE VQELQNDLDR ETSSLQELEA QKQDAQDRLD
460 470 480 490 500
EMDQQKAKLR DMLSDVRQKC QDETQMISSL KTQIQSQESD LKSQEDDLNR
510 520 530 540 550
AKSELNRLQQ EETQLEQSIQ AGRVQLETII KSLKSTQDEI NQARSKLSQL
560 570 580 590 600
HESRQEAHRS LEQYDQVLDG AHGASLTDLA NLSEGVSLAE RGSFGAMDDP
610 620 630 640 650
FKNKALLFSN NTQELHPDPF QTEDPFKSDP FKGADPFKGD PFQNDPFAEQ
660 670 680 690 700
QTTSTDPFGG DPFKESDPFR GSATDDFFKK QTKNDPFTSD PFTKNPSLPS
710 720 730 740 750
KLDPFESSDP FSSSSVSSKG SDPFGTLDPF GSGSFNSAEG FADFSQMSKP
760 770 780 790 800
PPSGPFTSSL GGAGFSDDPF KSKQDTPALP PKKPAPPRPK PPSGKSTPVS
810 820 830 840 850
QLGSADFPEA PDPFQPLGAD SGDPFQSKKG FGDPFSGKDP FVPSSAAKPS
860
KASASGFADF TSVS
Length:864
Mass (Da):94,255
Last modified:May 1, 2000 - v1
Checksum:iF4126069F6E00387
GO
Isoform 2 (identifier: Q9UBC2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     863-864: VS → FGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAIALSKADMPAA

Show »
Length:910
Mass (Da):99,606
Checksum:iF56CC554F539B5FE
GO
Isoform 3 (identifier: Q9UBC2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     750-864: PPPSGPFTSS...SGFADFTSVS → VKVHL

Show »
Length:754
Mass (Da):83,248
Checksum:i5FFC0740FA78FC8B
GO
Isoform 4 (identifier: Q9UBC2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-601: DDPF → VKVE
     602-864: Missing.

Note: No experimental confirmation available.
Show »
Length:601
Mass (Da):66,479
Checksum:i9709A5D16D1E126A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti680 – 6801K → E in BAG59115 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei598 – 6014DDPF → VKVE in isoform 4. 1 PublicationVSP_046904
Alternative sequencei602 – 864263Missing in isoform 4. 1 PublicationVSP_046905Add
BLAST
Alternative sequencei750 – 864115PPPSG…FTSVS → VKVHL in isoform 3. 2 PublicationsVSP_045429Add
BLAST
Alternative sequencei863 – 8642VS → FGNEEQQLAWAKRESEKAEQ ERLARLRRQEQEDLELAIAL SKADMPAA in isoform 2. 1 PublicationVSP_042200

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF110265 mRNA. Translation: AAF21930.1.
AB015346 mRNA. Translation: BAA88118.1.
AK024166 mRNA. Translation: BAG51266.1.
AK296473 mRNA. Translation: BAG59115.1.
AC008764 Genomic DNA. No translation available.
AC020917 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84542.1.
BC131590 mRNA. Translation: AAI31591.1.
BC142716 mRNA. Translation: AAI42717.1.
CCDSiCCDS32944.1. [Q9UBC2-1]
CCDS58653.1. [Q9UBC2-3]
CCDS58654.1. [Q9UBC2-2]
CCDS59363.1. [Q9UBC2-4]
RefSeqiNP_001245303.1. NM_001258374.1. [Q9UBC2-2]
NP_001245304.1. NM_001258375.1. [Q9UBC2-3]
NP_001245305.1. NM_001258376.1. [Q9UBC2-4]
NP_067058.1. NM_021235.2. [Q9UBC2-1]
UniGeneiHs.654639.
Hs.744842.

Genome annotation databases

EnsembliENST00000248070; ENSP00000248070; ENSG00000127527.
ENST00000455140; ENSP00000393313; ENSG00000127527. [Q9UBC2-2]
ENST00000597937; ENSP00000472267; ENSG00000127527. [Q9UBC2-4]
GeneIDi58513.
KEGGihsa:58513.
UCSCiuc002ndx.4. human. [Q9UBC2-2]
uc002ndz.2. human. [Q9UBC2-1]
uc002nea.2. human.
uc002nec.2. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF110265 mRNA. Translation: AAF21930.1.
AB015346 mRNA. Translation: BAA88118.1.
AK024166 mRNA. Translation: BAG51266.1.
AK296473 mRNA. Translation: BAG59115.1.
AC008764 Genomic DNA. No translation available.
AC020917 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84542.1.
BC131590 mRNA. Translation: AAI31591.1.
BC142716 mRNA. Translation: AAI42717.1.
CCDSiCCDS32944.1. [Q9UBC2-1]
CCDS58653.1. [Q9UBC2-3]
CCDS58654.1. [Q9UBC2-2]
CCDS59363.1. [Q9UBC2-4]
RefSeqiNP_001245303.1. NM_001258374.1. [Q9UBC2-2]
NP_001245304.1. NM_001258375.1. [Q9UBC2-3]
NP_001245305.1. NM_001258376.1. [Q9UBC2-4]
NP_067058.1. NM_021235.2. [Q9UBC2-1]
UniGeneiHs.654639.
Hs.744842.

3D structure databases

ProteinModelPortaliQ9UBC2.
SMRiQ9UBC2. Positions 11-105, 121-214, 269-362.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121840. 22 interactions.
IntActiQ9UBC2. 14 interactions.
MINTiMINT-1538779.
STRINGi9606.ENSP00000248070.

Polymorphism and mutation databases

BioMutaiEPS15L1.
DMDMi61223942.

Proteomic databases

MaxQBiQ9UBC2.
PaxDbiQ9UBC2.
PRIDEiQ9UBC2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248070; ENSP00000248070; ENSG00000127527.
ENST00000455140; ENSP00000393313; ENSG00000127527. [Q9UBC2-2]
ENST00000597937; ENSP00000472267; ENSG00000127527. [Q9UBC2-4]
GeneIDi58513.
KEGGihsa:58513.
UCSCiuc002ndx.4. human. [Q9UBC2-2]
uc002ndz.2. human. [Q9UBC2-1]
uc002nea.2. human.
uc002nec.2. human.

Organism-specific databases

CTDi58513.
GeneCardsiGC19M016466.
HGNCiHGNC:24634. EPS15L1.
HPAiHPA019237.
HPA055309.
neXtProtiNX_Q9UBC2.
PharmGKBiPA134906266.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG301764.
GeneTreeiENSGT00760000118985.
HOGENOMiHOG000004804.
HOVERGENiHBG005591.
InParanoidiQ9UBC2.
OMAiSQMSKPP.
OrthoDBiEOG7JHM68.
PhylomeDBiQ9UBC2.
TreeFamiTF324293.

Enzyme and pathway databases

ReactomeiREACT_12484. EGFR downregulation.

Miscellaneous databases

ChiTaRSiEPS15L1. human.
GeneWikiiEPS15L1.
GenomeRNAii58513.
NextBioi65055.
PROiQ9UBC2.

Gene expression databases

BgeeiQ9UBC2.
CleanExiHS_EPS15L1.
ExpressionAtlasiQ9UBC2. baseline and differential.
GenevisibleiQ9UBC2. HS.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR000261. EPS15_homology.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
SM00027. EH. 3 hits.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 4 hits.
PS50031. EH. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Nakashima S., Morinaka K., Ikeda M., Kishida S., Koyama S., Kikuchi A.
    Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Selection system for genes encoding nuclear-targeted proteins."
    Ueki N., Oda T., Kondo M., Yano K., Noguchi T., Muramatsu M.-A.
    Nat. Biotechnol. 16:1338-1342(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], SUBCELLULAR LOCATION.
    Tissue: Fetal brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Thalamus.
  4. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
  7. "eps15 and eps15R are essential components of the endocytic pathway."
    Carbone R., Fre S., Iannolo G., Belleudi F., Mancini P., Pelicci P.G., Torrisi M.R., Di Fiore P.P.
    Cancer Res. 57:5498-5504(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
    Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
    Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. Cited for: INTERACTION WITH UBQLN1.
  10. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-244; SER-255; SER-560; THR-577 AND THR-797, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "FCHo proteins are nucleators of clathrin-mediated endocytosis."
    Henne W.M., Boucrot E., Meinecke M., Evergren E., Vallis Y., Mittal R., McMahon H.T.
    Science 328:1281-1284(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FCHO2.
  16. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  17. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-255, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin beta1 endocytosis."
    Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A.
    Mol. Biol. Cell 23:2905-2916(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH DAB2.
  19. "Distinct and separable activities of the endocytic clathrin-coat components Fcho1/2 and AP-2 in developmental patterning."
    Umasankar P.K., Sanker S., Thieman J.R., Chakraborty S., Wendland B., Tsang M., Traub L.M.
    Nat. Cell Biol. 14:488-501(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FCHO1.
  20. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-229; THR-366; SER-371; SER-377; SER-593; SER-666; SER-734 AND SER-793, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiEP15R_HUMAN
AccessioniPrimary (citable) accession number: Q9UBC2
Secondary accession number(s): A2RRF3, A5PL29, B4DKA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2004
Last sequence update: May 1, 2000
Last modified: July 22, 2015
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Studies in clathrin-mediated endocytosis used a siRNA mixture of EPS15 and EPS15L1.1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.