Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein spire

Gene

spir

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as an actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Promotes dissociation of capu from the barbed end of actin filaments. Involved in intracellular vesicle transport along actin fibers, providing a novel link between actin cytoskeleton dynamics and intracellular transport. Required for localization of determinants within the developing oocyte to the posterior pole and to the dorsal anterior corner. Links Rho family signaling and Jnk function to the actin cytoskeleton.5 Publications

GO - Molecular functioni

  • actin binding Source: FlyBase
  • microtubule binding Source: FlyBase

GO - Biological processi

  • actin cytoskeleton organization Source: FlyBase
  • actin filament-based process Source: FlyBase
  • actin filament network formation Source: FlyBase
  • actin filament organization Source: FlyBase
  • actin nucleation Source: FlyBase
  • chorion-containing eggshell formation Source: FlyBase
  • karyosome formation Source: FlyBase
  • oogenesis Source: FlyBase
  • pole plasm assembly Source: FlyBase
  • pole plasm oskar mRNA localization Source: FlyBase
  • pole plasm RNA localization Source: FlyBase
  • protein transport Source: UniProtKB-KW
  • regulation of cytoskeleton organization Source: FlyBase
  • vesicle-mediated transport Source: FlyBase
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Protein transport, Transport

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein spire
Gene namesi
Name:spirImported
Synonyms:p150-SpirImported
ORF Names:CG10076
OrganismiDrosophila melanogaster (Fruit fly)
Taxonomic identifieri7227 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
Proteomesi
  • UP000000803 Componenti: Chromosome 2L

Organism-specific databases

FlyBaseiFBgn0003475. spir.

Subcellular locationi

GO - Cellular componenti

  • cell cortex Source: FlyBase
  • cytoplasm Source: FlyBase
  • cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  • cytoskeleton Source: UniProtKB-SubCell
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane

Pathology & Biotechi

Disruption phenotypei

Flies display premature microtubule-dependent cytoplasmic streaming; failure in the orientation of microtubule plus ends towards the posterior pole.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi232Y → K: Abolishes interaction with capu. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003095731 – 1020Protein spireAdd BLAST1020

Post-translational modificationi

Phosphorylated by Jnk kinase (bsk).1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9U1K1.
PRIDEiQ9U1K1.

Expressioni

Developmental stagei

Expressed both maternally and zygotically.1 Publication

Gene expression databases

BgeeiFBgn0003475.
ExpressionAtlasiQ9U1K1. baseline.
GenevisibleiQ9U1K1. DM.

Interactioni

Subunit structurei

Interacts with bsk, Rho1, Rac1, Cdc42 and wash. Interacts with capu.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
faxQ95RI52EBI-3431623,EBI-147695

GO - Molecular functioni

  • actin binding Source: FlyBase
  • microtubule binding Source: FlyBase

Protein-protein interaction databases

BioGridi69994. 13 interactors.
DIPiDIP-17301N.
IntActiQ9U1K1. 11 interactors.
MINTiMINT-295231.
STRINGi7227.FBpp0080884.

Structurei

Secondary structure

11020
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi374 – 383Combined sources10
Helixi400 – 408Combined sources9
Helixi431 – 438Combined sources8
Helixi463 – 473Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3MMVX-ray2.80X429-447[»]
3MN5X-ray1.50S448-485[»]
3MN6X-ray2.00X/Y/Z397-415[»]
3MN7X-ray2.00S441-479[»]
3MN9X-ray2.00X372-390[»]
3UE5X-ray2.76B428-485[»]
4EFHX-ray2.48B428-485[»]
ProteinModelPortaliQ9U1K1.
SMRiQ9U1K1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9U1K1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini90 – 327KINDPROSITE-ProRule annotationAdd BLAST238
Domaini399 – 417WH2 1PROSITE-ProRule annotationAdd BLAST19
Domaini463 – 480WH2 2PROSITE-ProRule annotationAdd BLAST18

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni705 – 725Spir-boxAdd BLAST21

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi205 – 220His-richSequence analysisAdd BLAST16
Compositional biasi792 – 877Ser-richSequence analysisAdd BLAST86

Domaini

Binds to actin monomers via the WH2 domain.1 Publication
The Spir-box targets binding to intracellular membrane structures.By similarity

Sequence similaritiesi

Belongs to the spire family.Curated
Contains 1 KIND domain.PROSITE-ProRule annotation
Contains 2 WH2 domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IK9H. Eukaryota.
ENOG4111E0J. LUCA.
GeneTreeiENSGT00390000003058.
InParanoidiQ9U1K1.
KOiK02098.
OMAiGFNDWAR.
OrthoDBiEOG091G0CDG.
PhylomeDBiQ9U1K1.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR011019. KIND_dom.
IPR029901. Spire.
IPR003124. WH2_dom.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR21345. PTHR21345. 4 hits.
PfamiPF16474. KIND. 2 hits.
[Graphical view]
SMARTiSM00750. KIND. 1 hit.
SM00246. WH2. 2 hits.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS51377. KIND. 1 hit.
PS51082. WH2. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A1 Publication (identifier: Q9U1K1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTEHQAEEQA DTPPTKVKAT PTPTPSGKFK DAKEDAFLST SPDSANGDAQ
60 70 80 90 100
HKLPADQLAM SSSAHPQQAG QARPLILQAF HRCSSPEQCV TLHDILDSFK
110 120 130 140 150
APLSEDQAWA LIHQFAGLYH QVAVQAHTCA ADYEAALPTG FELHFHRDGS
160 170 180 190 200
VHFSGPDQLT PKEQLQQEQI PLPPQHDVIV DQPDHSASSS GDSSVINRAF
210 220 230 240 250
DNSNHHHHHQ HHHPPLVVSH RKIISELAEI VYTALDYNLP EDEECQVSQE
260 270 280 290 300
LENLFNFMTA DETDDDCIDE GIDEGDKRWD DESEEERNDT KELEHIIETC
310 320 330 340 350
RNHIKTTLPE NHYRAVCRAL VTETIELRVF LQQVLNNEAG AEKLIKASES
360 370 380 390 400
SATTQQELAK LGFNDWARFW VQVIDELRRG VRLKKSNHER TPIEYELTPY
410 420 430 440 450
EILMGDIRAK KYQLRKVMVN GDIPPRVKKD AHAMILEFIR SRPPLKKASD
460 470 480 490 500
RQLGPPRMCE PSPREQLMES IRKGKELKQI TPPEAPTLRE RVLPSANSTL
510 520 530 540 550
SRSRQRLIKV DFSKFQDDDL FYDENSISSS HSTAATHQHH PHFAEMHRCS
560 570 580 590 600
QPKMPPYPFG GYMVPSQARQ DCRETASLMR PRRTMEPAKQ VPPPEEPSFT
610 620 630 640 650
KDEYHKFYDT ALESYDLATQ CESRRASLRR HTIVGCQSNL DETHSMPPTR
660 670 680 690 700
PESRQSDDVS KETPKRSPAE QTHPSDEGSS TSSLGPWNKS FMDKQTWMER
710 720 730 740 750
GDDRLSVTLA EIVHIRSVMT KAELEGLPMD VRVKEDVEKR RVCFLCLRTR
760 770 780 790 800
FSFFGPWGIQ CKLCQRTVCA KCYTKMRIPS EHFRNVPLVL ISPSLLSSPA
810 820 830 840 850
SSSTPSPSHH AQQAHSSSTG NIMDDQFPKS LIERLLRSES DRKTRSTVGS
860 870 880 890 900
APSSPKHQRS NMSTPGISVG PGASSSSAAA TGQAVEALHD QATMSSSYSA
910 920 930 940 950
AMRPSGVHQQ QKQHYNNAMS RSMEGPRSLP VHSPAYRPLS NNSTLERKSR
960 970 980 990 1000
FSRGFNLFSS GSHLAQTQEQ KENLRGEQVT VCNDCQGLVN EITSSVKQKR
1010 1020
SSARNRTIQN LTLDLTPVWK
Length:1,020
Mass (Da):114,867
Last modified:May 1, 2000 - v1
Checksum:i010CD024F9ABC078
GO
Isoform B1 Publication (identifier: Q9U1K1-2) [UniParc]FASTAAdd to basket
Also known as: Long1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     585-614: MEPAKQVPPPEEPSFTKDEYHKFYDTALES → T

Show »
Length:991
Mass (Da):111,475
Checksum:i5A39B9F07136E212
GO
Isoform C1 Publication (identifier: Q9U1K1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-96: TEHQAEEQAD...EQCVTLHDIL → EARPAKRSTA...KPRQAIRSSK
     97-491: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:625
Mass (Da):69,401
Checksum:i6B020E5746568D77
GO
Isoform D1 Publication (identifier: Q9U1K1-4) [UniParc]FASTAAdd to basket
Also known as: Short1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     338-338: Missing.
     585-586: ME → SI
     587-1020: Missing.

Show »
Length:585
Mass (Da):66,418
Checksum:i8F2F09E9AB96CF7F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti53L → M in AAF23615 (PubMed:10556052).Curated1
Sequence conflicti53L → M in AAF23616 (PubMed:10556052).Curated1
Sequence conflicti885V → A in AAF23615 (PubMed:10556052).Curated1

RNA editingi

Edited at position 734.2 Publications
Partially edited. Target of Adar.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural varianti734K → R in RNA edited version. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0525992 – 96TEHQA…LHDIL → EARPAKRSTAASVFRSHHMP RESDLVDIGSDASLYCGSDG ESSQAQSTSTSTPNPQTSSD QDLDQPQPTPRAAPRASASN NPPTPKPRQAIRSSK in isoform C. 2 PublicationsAdd BLAST95
Alternative sequenceiVSP_05260097 – 491Missing in isoform C. 2 PublicationsAdd BLAST395
Alternative sequenceiVSP_052601338Missing in isoform D. 2 Publications1
Alternative sequenceiVSP_052602585 – 614MEPAK…TALES → T in isoform B. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_052603585 – 586ME → SI in isoform D. 2 Publications2
Alternative sequenceiVSP_052604587 – 1020Missing in isoform D. 2 PublicationsAdd BLAST434

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF184975 mRNA. Translation: AAF23615.1.
AF184976 mRNA. Translation: AAF23616.1.
AJ238876 mRNA. Translation: CAB62901.1.
AE014134 Genomic DNA. Translation: AAF53884.2.
AE014134 Genomic DNA. Translation: AAN11070.1.
AE014134 Genomic DNA. Translation: AAN11071.1.
AE014134 Genomic DNA. Translation: AAN11072.2.
AY075586 mRNA. Translation: AAL68390.1.
AY089503 mRNA. Translation: AAL90241.1.
BT016094 mRNA. Translation: AAV36979.1.
RefSeqiNP_001246102.1. NM_001259173.1.
NP_001286100.1. NM_001299171.1.
NP_524854.2. NM_080115.3. [Q9U1K1-2]
NP_724254.1. NM_165323.3. [Q9U1K1-1]
NP_724255.1. NM_165324.2. [Q9U1K1-4]
NP_724256.2. NM_165325.3. [Q9U1K1-3]
UniGeneiDm.3356.

Genome annotation databases

EnsemblMetazoaiFBtr0081352; FBpp0080884; FBgn0003475. [Q9U1K1-1]
GeneIDi45931.
KEGGidme:Dmel_CG10076.
UCSCiCG10076-RA. d. melanogaster. [Q9U1K1-1]

Keywords - Coding sequence diversityi

Alternative splicing, RNA editing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF184975 mRNA. Translation: AAF23615.1.
AF184976 mRNA. Translation: AAF23616.1.
AJ238876 mRNA. Translation: CAB62901.1.
AE014134 Genomic DNA. Translation: AAF53884.2.
AE014134 Genomic DNA. Translation: AAN11070.1.
AE014134 Genomic DNA. Translation: AAN11071.1.
AE014134 Genomic DNA. Translation: AAN11072.2.
AY075586 mRNA. Translation: AAL68390.1.
AY089503 mRNA. Translation: AAL90241.1.
BT016094 mRNA. Translation: AAV36979.1.
RefSeqiNP_001246102.1. NM_001259173.1.
NP_001286100.1. NM_001299171.1.
NP_524854.2. NM_080115.3. [Q9U1K1-2]
NP_724254.1. NM_165323.3. [Q9U1K1-1]
NP_724255.1. NM_165324.2. [Q9U1K1-4]
NP_724256.2. NM_165325.3. [Q9U1K1-3]
UniGeneiDm.3356.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3MMVX-ray2.80X429-447[»]
3MN5X-ray1.50S448-485[»]
3MN6X-ray2.00X/Y/Z397-415[»]
3MN7X-ray2.00S441-479[»]
3MN9X-ray2.00X372-390[»]
3UE5X-ray2.76B428-485[»]
4EFHX-ray2.48B428-485[»]
ProteinModelPortaliQ9U1K1.
SMRiQ9U1K1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi69994. 13 interactors.
DIPiDIP-17301N.
IntActiQ9U1K1. 11 interactors.
MINTiMINT-295231.
STRINGi7227.FBpp0080884.

Proteomic databases

PaxDbiQ9U1K1.
PRIDEiQ9U1K1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0081352; FBpp0080884; FBgn0003475. [Q9U1K1-1]
GeneIDi45931.
KEGGidme:Dmel_CG10076.
UCSCiCG10076-RA. d. melanogaster. [Q9U1K1-1]

Organism-specific databases

CTDi45931.
FlyBaseiFBgn0003475. spir.

Phylogenomic databases

eggNOGiENOG410IK9H. Eukaryota.
ENOG4111E0J. LUCA.
GeneTreeiENSGT00390000003058.
InParanoidiQ9U1K1.
KOiK02098.
OMAiGFNDWAR.
OrthoDBiEOG091G0CDG.
PhylomeDBiQ9U1K1.

Miscellaneous databases

ChiTaRSispir. fly.
EvolutionaryTraceiQ9U1K1.
GenomeRNAii45931.
PROiQ9U1K1.

Gene expression databases

BgeeiFBgn0003475.
ExpressionAtlasiQ9U1K1. baseline.
GenevisibleiQ9U1K1. DM.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR011019. KIND_dom.
IPR029901. Spire.
IPR003124. WH2_dom.
IPR011011. Znf_FYVE_PHD.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PANTHERiPTHR21345. PTHR21345. 4 hits.
PfamiPF16474. KIND. 2 hits.
[Graphical view]
SMARTiSM00750. KIND. 1 hit.
SM00246. WH2. 2 hits.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 2 hits.
PROSITEiPS51377. KIND. 1 hit.
PS51082. WH2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSPIR_DROME
AccessioniPrimary (citable) accession number: Q9U1K1
Secondary accession number(s): Q5U0Z8
, Q8INV3, Q8INV4, Q8INV5, Q8SXP3, Q8T8P8, Q9U4F0, Q9U4F1, Q9VIN3, Q9VIN4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.