Q9U1K1 (SPIR_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein spire | ||||||
| Gene names |
| ||||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||||
| Taxonomic identifier | 7227 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 1020 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as an actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Promotes dissociation of capu from the barbed end of actin filaments. Involved in intracellular vesicle transport along actin fibers, providing a novel link between actin cytoskeleton dynamics and intracellular transport. Required for localization of determinants within the developing oocyte to the posterior pole and to the dorsal anterior corner. Links Rho family signaling and Jnk function to the actin cytoskeleton. Ref.1 Ref.2 Ref.7 Ref.10 Ref.11 |
| Subunit structure | Interacts with bsk, Rho1, Rac1, Cdc42 and wash. Interacts with capu. Ref.1 Ref.2 Ref.9 Ref.10 |
| Subcellular location | Cytoplasm › cytoskeleton. Cytoplasm › perinuclear region. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Note: Punctate spots in perinuclear region and cytoplasm. Ref.2 Ref.10 |
| Developmental stage | Expressed both maternally and zygotically. Ref.1 |
| Domain | Binds to actin monomers via the WH2 domain. Ref.1 The Spir-box targets binding to intracellular membrane structures By similarity. UniProtKB Q08AE8 |
| Post-translational modification | Phosphorylated by Jnk kinase (bsk). Ref.2 |
| Disruption phenotype | Flies display premature microtubule-dependent cytoplasmic streaming; failure in the orientation of microtubule plus ends towards the posterior pole. Ref.1 |
| Sequence similarities | Belongs to the spire family. Contains 1 KIND domain. Contains 2 WH2 domains. |
| RNA editing | Edited at position 734. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| bsk | P92208 | 1 | EBI-91672,EBI-74487 | |
| CG14579 | Q9VRF5 | 1 | EBI-91672,EBI-99956 | |
| sax | Q7JQ36 | 1 | EBI-91672,EBI-121415 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A Ref.2 (identifier: Q9U1K1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B Ref.1 (identifier: Q9U1K1-2) Also known as: Long; The sequence of this isoform differs from the canonical sequence as follows: 585-614: MEPAKQVPPPEEPSFTKDEYHKFYDTALES → T | ||||||
| Isoform C Ref.3 (identifier: Q9U1K1-3) The sequence of this isoform differs from the canonical sequence as follows: 2-96: TEHQAEEQAD...EQCVTLHDIL → EARPAKRSTA...KPRQAIRSSK 97-491: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform D Ref.1 (identifier: Q9U1K1-4) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 338-338: Missing. 585-586: ME → SI 587-1020: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1020 | 1020 | Protein spire | PRO_0000309573 | |||||||
Regions | |||||||||||
| Domain | 90 – 327 | 238 | KIND | ||||||||
| Domain | 399 – 417 | 19 | WH2 1 | ||||||||
| Domain | 463 – 480 | 18 | WH2 2 | ||||||||
| Region | 705 – 725 | 21 | Spir-box | ||||||||
| Compositional bias | 205 – 220 | 16 | His-rich | ||||||||
| Compositional bias | 792 – 877 | 86 | Ser-rich | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 2 – 96 | 95 | TEHQA…LHDIL → EARPAKRSTAASVFRSHHMP RESDLVDIGSDASLYCGSDG ESSQAQSTSTSTPNPQTSSD QDLDQPQPTPRAAPRASASN NPPTPKPRQAIRSSK in isoform C. Ref.3 | VSP_052599 | |||||||
| Alternative sequence | 97 – 491 | 395 | Missing in isoform C. Ref.3 | VSP_052600 | |||||||
| Alternative sequence | 338 | 1 | Missing in isoform D. Ref.1 | VSP_052601 | |||||||
| Alternative sequence | 585 – 614 | 30 | MEPAK…TALES → T in isoform B. Ref.1 | VSP_052602 | |||||||
| Alternative sequence | 585 – 586 | 2 | ME → SI in isoform D. Ref.1 | VSP_052603 | |||||||
| Alternative sequence | 587 – 1020 | 434 | Missing in isoform D. Ref.1 | VSP_052604 | |||||||
| Natural variant | 734 | 1 | K → R in RNA edited version. Ref.8 | ||||||||
Experimental info | |||||||||||
| Mutagenesis | 232 | 1 | Y → K: Abolishes interaction with capu. Ref.10 | ||||||||
| Sequence conflict | 53 | 1 | L → M in AAF23615. Ref.1 | ||||||||
| Sequence conflict | 53 | 1 | L → M in AAF23616. Ref.1 | ||||||||
| Sequence conflict | 885 | 1 | V → A in AAF23615. Ref.1 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 463 – 473 | 11 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Spire contains actin binding domains and is related to ascidian posterior end mark-5." Wellington A., Emmons S., James B., Calley J., Grover M., Tolias P., Manseau L. Development 126:5267-5274(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B AND D), FUNCTION, INTERACTION WITH RHO1; RAC1 AND CDC42, DEVELOPMENTAL STAGE, ACTIN-BINDING, DISRUPTION PHENOTYPE. Tissue: Ovary. |
| [2] | "The p150-Spir protein provides a link between c-Jun N-terminal kinase function and actin reorganization." Otto I.M., Raabe T., Rennefahrt U.E.E., Bork P., Rapp U.R., Kerkhoff E. Curr. Biol. 10:345-348(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, INTERACTION WITH BSK, SUBCELLULAR LOCATION, PHOSPHORYLATION. Tissue: Embryo. |
| [3] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [4] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [5] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS C AND D), RNA EDITING OF POSITION 734. Strain: Berkeley. Tissue: Embryo and Head. |
| [6] | Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A., Pacleb J.M., Park S., Wan K.H., Yu C., Rubin G.M., Celniker S.E. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 196-1020 (ISOFORM B). Strain: Berkeley. Tissue: Embryo. |
| [7] | "Drosophila Spire is an actin nucleation factor." Quinlan M.E., Heuser J.E., Kerkhoff E., Mullins R.D. Nature 433:382-388(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "RNA editing in Drosophila melanogaster: new targets and functional consequences." Stapleton M., Carlson J.W., Celniker S.E. RNA 12:1922-1932(2006) [PubMed] [Europe PMC] [Abstract] Cited for: RNA EDITING OF POSITION 734. |
| [9] | "Wash functions downstream of Rho and links linear and branched actin nucleation factors." Liu R., Abreu-Blanco M.T., Barry K.C., Linardopoulou E.V., Osborn G.E., Parkhurst S.M. Development 136:2849-2860(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH WASH. |
| [10] | "Structure and function of the interacting domains of Spire and Fmn-family formins." Vizcarra C.L., Kreutz B., Rodal A.A., Toms A.V., Lu J., Zheng W., Quinlan M.E., Eck M.J. Proc. Natl. Acad. Sci. U.S.A. 108:11884-11889(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CAPU, SUBCELLULAR LOCATION, MUTAGENESIS OF TYR-232. |
| [11] | "Structures of actin-bound Wiskott-Aldrich syndrome protein homology 2 (WH2) domains of Spire and the implication for filament nucleation." Ducka A.M., Joel P., Popowicz G.M., Trybus K.M., Schleicher M., Noegel A.A., Huber R., Holak T.A., Sitar T. Proc. Natl. Acad. Sci. U.S.A. 107:11757-11762(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 448-485 IN COMPLEX WITH ACTIN, FUNCTION. |
| [12] | "Multiple forms of Spire-actin complexes and their functional consequences." Chen C.K., Sawaya M.R., Phillips M.L., Reisler E., Quinlan M.E. J. Biol. Chem. 287:10684-10692(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.76 ANGSTROMS) OF 428-485 IN COMPLEX WITH ACTIN. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF184975 mRNA. Translation: AAF23615.1. AF184976 mRNA. Translation: AAF23616.1. AJ238876 mRNA. Translation: CAB62901.1. AE014134 Genomic DNA. Translation: AAF53884.2. AE014134 Genomic DNA. Translation: AAN11070.1. AE014134 Genomic DNA. Translation: AAN11071.1. AE014134 Genomic DNA. Translation: AAN11072.2. AY075586 mRNA. Translation: AAL68390.1. AY089503 mRNA. Translation: AAL90241.1. BT016094 mRNA. Translation: AAV36979.1. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001246102.1. NM_001259173.1. NP_524854.2. NM_080115.3. NP_724254.1. NM_165323.2. NP_724255.1. NM_165324.2. NP_724256.2. NM_165325.2. | ||||||||||||||||||||||||||||||
| UniGene | Dm.3356. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9U1K1. | ||||||||||||||||||||||||||||||
| SMR | Q9U1K1. Positions 222-331. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-17301N. | ||||||||||||||||||||||||||||||
| IntAct | Q9U1K1. 3 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-295231. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q9U1K1. | ||||||||||||||||||||||||||||||
| PRIDE | Q9U1K1. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| EnsemblMetazoa | FBtr0081352; FBpp0080884; FBgn0003475. | ||||||||||||||||||||||||||||||
| GeneID | 45931. | ||||||||||||||||||||||||||||||
| KEGG | dme:Dmel_CG10076. | ||||||||||||||||||||||||||||||
| UCSC | CG10076-RA. d. melanogaster. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 45931. | ||||||||||||||||||||||||||||||
| FlyBase | FBgn0003475. spir. | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | NOG69783. | ||||||||||||||||||||||||||||||
| GeneTree | ENSGT00390000003058. | ||||||||||||||||||||||||||||||
| InParanoid | Q9U1K1. | ||||||||||||||||||||||||||||||
| KO | K02098. | ||||||||||||||||||||||||||||||
| OMA | WALIYQF. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG44TMQP. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q9U1K1. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| Bgee | Q9U1K1. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 3.30.40.10. 1 hit. | ||||||||||||||||||||||||||||||
| InterPro | IPR011019. KIND. IPR003124. WH2_dom. IPR011011. Znf_FYVE_PHD. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] | ||||||||||||||||||||||||||||||
| SMART | SM00750. KIND. 1 hit. SM00246. WH2. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF57903. FYVE_PHD_ZnF. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS51377. KIND. 1 hit. PS51082. WH2. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| ChiTaRS | spir. drosophila. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9U1K1. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 45931. | ||||||||||||||||||||||||||||||
| NextBio | 838510. | ||||||||||||||||||||||||||||||
Entry information
| Entry name | SPIR_DROME | ||||||||
| Accession | Primary (citable) accession number: Q9U1K1 Secondary accession number(s): Q5U0Z8 Q9VIN4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
