Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MACPF domain-containing protein At4g24290

Gene

At4g24290

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Hypersensitive response, Immunity, Innate immunity, Plant defense

Names & Taxonomyi

Protein namesi
Recommended name:
MACPF domain-containing protein At4g24290
Gene namesi
Ordered Locus Names:At4g24290
ORF Names:T22A6.120
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 4

Organism-specific databases

TAIRiAT4G24290.

Subcellular locationi

GO - Cellular componenti

  • plasma membrane Source: TAIR
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004155421 – 606MACPF domain-containing protein At4g24290Add BLAST606

Proteomic databases

PaxDbiQ9STW5.
PRIDEiQ9STW5.

PTM databases

iPTMnetiQ9STW5.
SwissPalmiQ9STW5.

Expressioni

Gene expression databases

GenevisibleiQ9STW5. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT4G24290.2.

Structurei

3D structure databases

ProteinModelPortaliQ9STW5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 332MACPFPROSITE-ProRule annotationAdd BLAST332

Sequence similaritiesi

Contains 1 MACPF domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IK3X. Eukaryota.
ENOG410Y9MJ. LUCA.
HOGENOMiHOG000238669.
InParanoidiQ9STW5.
OMAiYEPIGPW.
OrthoDBiEOG093604KU.
PhylomeDBiQ9STW5.

Family and domain databases

InterProiIPR020864. MACPF.
[Graphical view]
PfamiPF01823. MACPF. 1 hit.
[Graphical view]
SMARTiSM00457. MACPF. 1 hit.
[Graphical view]
PROSITEiPS51412. MACPF_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9STW5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALRLPASKA AEVAIGSIGC GYDLAIDLRL KYCKGGSKDS RLLDIKEGDD
60 70 80 90 100
NCEIVLPGGI SIPNVSKSIK CDKGERMRFR SDILPFQQMA EQFNQELSLA
110 120 130 140 150
GKIPSGLFNA MFEFSSCWQK DAAYTKNLAF DGVFISLYSV ALDKSQVLLR
160 170 180 190 200
EHVKQAVPST WDPAALARFI DIYGTHIIVS VKMGGKDVIY AKQQHSSKLQ
210 220 230 240 250
PEDLQKRLKE VADKRFVEAS VVHNTGSERV QASSKVETKE QRLRFADTSS
260 270 280 290 300
LGSYANKEDY VFMCKRRGGN DNRNLMHNEW LQTVQMEPDV ISMSFIPITS
310 320 330 340 350
LLNGVPGSGF LSHAINLYLR YKPPIEELHQ FLEFQLPRQW APVFSELPLG
360 370 380 390 400
PQRKQQSCAS LQFSFFGPKL YVNTTPVDVG KRPITGMRLY LEGRRSNRLA
410 420 430 440 450
IHLQHLSSLP KIYQLEDDLN RSIRQESHDR RYYEKVNWKN YSHVCTEPVE
460 470 480 490 500
SDDDLSVVTG AQLHVESHGF KNVLFLRLCF SRVVGATLVK NSEWDEAVGF
510 520 530 540 550
APKSGLISTL ISHHFTAAQK PPPRPADVNI NSAIYPGGPP VPTQAPKLLK
560 570 580 590 600
FVDTSEMTRG PQESPGYWVV SGARLLVEKG KISLKVKYSL FTPILGDEVI

EEAYEG
Length:606
Mass (Da):67,934
Last modified:May 1, 2000 - v1
Checksum:iEEE60EB366FEAE6C
GO
Isoform 2 (identifier: Q9STW5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-350: YKPPIEELHQFLEFQLPRQWAPVFSELPLG → CKPINHLRFVHFFLELFFILVVSFTFRLEV
     351-606: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:350
Mass (Da):39,333
Checksum:i52562E01078D4FEF
GO

Sequence cautioni

The sequence BX826919 differs from that shown. Sequencing errors.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti280W → R in ACD89064 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042282321 – 350YKPPI…ELPLG → CKPINHLRFVHFFLELFFIL VVSFTFRLEV in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_042283351 – 606Missing in isoform 2. 1 PublicationAdd BLAST256

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL078637 Genomic DNA. Translation: CAB45064.1.
AL161561 Genomic DNA. Translation: CAB79339.1.
CP002687 Genomic DNA. Translation: AEE84885.1.
CP002687 Genomic DNA. Translation: AEE84886.1.
BX826919 mRNA. No translation available.
BT032874 mRNA. Translation: ACD89064.1.
PIRiT09892.
RefSeqiNP_567698.1. NM_118562.2. [Q9STW5-2]
NP_849433.1. NM_179102.5. [Q9STW5-1]
UniGeneiAt.3459.
At.67135.

Genome annotation databases

EnsemblPlantsiAT4G24290.2; AT4G24290.2; AT4G24290. [Q9STW5-1]
GeneIDi828532.
GrameneiAT4G24290.2; AT4G24290.2; AT4G24290.
KEGGiath:AT4G24290.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL078637 Genomic DNA. Translation: CAB45064.1.
AL161561 Genomic DNA. Translation: CAB79339.1.
CP002687 Genomic DNA. Translation: AEE84885.1.
CP002687 Genomic DNA. Translation: AEE84886.1.
BX826919 mRNA. No translation available.
BT032874 mRNA. Translation: ACD89064.1.
PIRiT09892.
RefSeqiNP_567698.1. NM_118562.2. [Q9STW5-2]
NP_849433.1. NM_179102.5. [Q9STW5-1]
UniGeneiAt.3459.
At.67135.

3D structure databases

ProteinModelPortaliQ9STW5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT4G24290.2.

PTM databases

iPTMnetiQ9STW5.
SwissPalmiQ9STW5.

Proteomic databases

PaxDbiQ9STW5.
PRIDEiQ9STW5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT4G24290.2; AT4G24290.2; AT4G24290. [Q9STW5-1]
GeneIDi828532.
GrameneiAT4G24290.2; AT4G24290.2; AT4G24290.
KEGGiath:AT4G24290.

Organism-specific databases

TAIRiAT4G24290.

Phylogenomic databases

eggNOGiENOG410IK3X. Eukaryota.
ENOG410Y9MJ. LUCA.
HOGENOMiHOG000238669.
InParanoidiQ9STW5.
OMAiYEPIGPW.
OrthoDBiEOG093604KU.
PhylomeDBiQ9STW5.

Miscellaneous databases

PROiQ9STW5.

Gene expression databases

GenevisibleiQ9STW5. AT.

Family and domain databases

InterProiIPR020864. MACPF.
[Graphical view]
PfamiPF01823. MACPF. 1 hit.
[Graphical view]
SMARTiSM00457. MACPF. 1 hit.
[Graphical view]
PROSITEiPS51412. MACPF_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMACP2_ARATH
AccessioniPrimary (citable) accession number: Q9STW5
Secondary accession number(s): B3DN86, F4JQ79
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 22, 2012
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.