Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9R1V7

- ADA23_MOUSE

UniProt

Q9R1V7 - ADA23_MOUSE

Protein

Disintegrin and metalloproteinase domain-containing protein 23

Gene

Adam23

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein By similarity.By similarity

    GO - Molecular functioni

    1. metalloendopeptidase activity Source: InterPro
    2. protein binding Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW

    Keywords - Biological processi

    Cell adhesion

    Protein family/group databases

    MEROPSiM12.979.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disintegrin and metalloproteinase domain-containing protein 23
    Short name:
    ADAM 23
    Alternative name(s):
    Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
    Short name:
    MDC-3
    Gene namesi
    Name:Adam23
    Synonyms:Mdc3
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:1345162. Adam23.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 5555Sequence AnalysisAdd
    BLAST
    Propeptidei56 – 283228Sequence AnalysisPRO_0000029120Add
    BLAST
    Chaini284 – 829546Disintegrin and metalloproteinase domain-containing protein 23PRO_0000029121Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi97 – 971N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi260 – 2601N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi405 ↔ 488By similarity
    Disulfide bondi447 ↔ 472By similarity
    Disulfide bondi449 ↔ 456By similarity
    Glycosylationi544 – 5441N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi545 – 5451N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi557 ↔ 577By similarity
    Glycosylationi661 – 6611N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi729 – 7291N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi733 ↔ 748By similarity
    Disulfide bondi742 ↔ 754By similarity
    Disulfide bondi756 ↔ 765By similarity

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ9R1V7.
    PaxDbiQ9R1V7.
    PRIDEiQ9R1V7.

    PTM databases

    PhosphoSiteiQ9R1V7.

    Expressioni

    Tissue specificityi

    Brain specific.1 Publication

    Developmental stagei

    On E15 embryo the level of isoform Gamma exceeded that of isoform Alpha and isoform Beta and decreased after birth. On P10 post neonatal, the level of isoform Gamma is undetectable and isoform Alpha and isoform Beta are expressed again.1 Publication

    Gene expression databases

    ArrayExpressiQ9R1V7.
    BgeeiQ9R1V7.
    CleanExiMM_ADAM23.
    GenevestigatoriQ9R1V7.

    Interactioni

    Subunit structurei

    Can bind to LGI1 and LGI4.

    Protein-protein interaction databases

    BioGridi204715. 1 interaction.
    IntActiQ9R1V7. 3 interactions.
    MINTiMINT-1177148.
    STRINGi10090.ENSMUSP00000109738.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9R1V7.
    SMRiQ9R1V7. Positions 291-770.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini284 – 789506ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini811 – 82919CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei790 – 81021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini296 – 493198Peptidase M12BPROSITE-ProRule annotationAdd
    BLAST
    Domaini499 – 58587DisintegrinPROSITE-ProRule annotationAdd
    BLAST
    Domaini729 – 76638EGF-likePROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi586 – 60823Cys-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 disintegrin domain.PROSITE-ProRule annotation
    Contains 1 EGF-like domain.PROSITE-ProRule annotation
    Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG256419.
    GeneTreeiENSGT00680000099751.
    HOGENOMiHOG000231962.
    HOVERGENiHBG050456.
    KOiK06837.

    Family and domain databases

    Gene3Di3.40.390.10. 1 hit.
    4.10.70.10. 1 hit.
    InterProiIPR006586. ADAM_Cys-rich.
    IPR001762. Blood-coag_inhib_Disintegrin.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR024079. MetalloPept_cat_dom.
    IPR001590. Peptidase_M12B.
    IPR002870. Peptidase_M12B_N.
    [Graphical view]
    PfamiPF08516. ADAM_CR. 1 hit.
    PF00200. Disintegrin. 1 hit.
    PF01562. Pep_M12B_propep. 1 hit.
    PF01421. Reprolysin. 1 hit.
    [Graphical view]
    SMARTiSM00608. ACR. 1 hit.
    SM00050. DISIN. 1 hit.
    SM00181. EGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF57552. SSF57552. 1 hit.
    PROSITEiPS50215. ADAM_MEPRO. 1 hit.
    PS50214. DISINTEGRIN_2. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform Alpha (identifier: Q9R1V7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKPPGSISRR PTLTGCSLPG ASCGPGRCPA GPVPARAPPC RLLLVLLLLP    50
    ALATSSRPRA RGAAAPSAPH WNETAEKTLG VLADEDNTLQ QNSSSRNTSY 100
    SSAVQKEITL PSRLVYYINQ DSESPYHVLD TKARHQQKHN KAVHLAQASF 150
    QIEAFGSKFI LDLTLNNGLL SSDYVEIHYE DGKQMYSKGG EHCYYHGSIR 200
    GVKDSRVALS TCNGLHGMFE DDTFVYMIEP LELTDDEKST GRPHIIQKTL 250
    AGQYSKQMKN LSTDGSDQWP LLPELQWLRR RKRAVNPSRG VFEEMKYLEL 300
    MIVNDHKTYK KHRSSHAHTN NFAKSVVNLV DSIYKEQLNT RVVLVAVETW 350
    TEKDHIDITI NPVQMLHDFS KYRQRIKQHA DAVHLISRVT FHYKRSSLSY 400
    FGGVCSRIRG VGVNEYGLPM AVAQVLSQSL AQNLGIQWEP SSRKPKCECI 450
    ESWGGCIMEE TGVSHSRKFS KCSILEYRDF LQRGGGACLF NRPTKLFEPT 500
    ECGNGYVEAG EECDCGFHVE CYGVCCKKCS LSNGAHCSDG PCCNNTSCLF 550
    QSRGYECRDA VNSCDITEYC TGDSGQCPPN LHKQDGYSCN QNQGRCYNGE 600
    CKTRDNQCQY IWGTKAAGSD KFCYEKLNTE GTEKGNCGKD GDRWIPCSKH 650
    DVFCGFLLCT NLTRAPRIGQ LQGEIIPTSF YHQGRVIDCS GAHVVLDDDT 700
    DVGYVEDGTP CGPSMMCLDR KCLQIQALNM SSCPLDSRGK VCSGHGVCSN 750
    EATCICDFTW AGTDCSIRDP VRNPNPPKDE GPKGPSATNL IIGSIAGAIL 800
    VAAIVLGGTG WGFKNVKKRR FDPTQQGPI 829
    Length:829
    Mass (Da):91,548
    Last modified:May 1, 2000 - v1
    Checksum:iF6EBCD69DD50F53A
    GO
    Isoform Beta (identifier: Q9R1V7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         784-814: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTVLALGVIFGGTGWGIE

    Show »
    Length:829
    Mass (Da):91,654
    Checksum:i96C2C8EBC078CF58
    GO
    Isoform Gamma (identifier: Q9R1V7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         784-829: GPSATNLIIG...RFDPTQQGPI → ETSRRGDSIP...SAMLPELLSL

    Show »
    Length:829
    Mass (Da):91,718
    Checksum:iFFDA2310B64408E3
    GO
    Isoform Delta (identifier: Q9R1V7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         690-690: S → R
         691-829: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:690
    Mass (Da):77,058
    Checksum:i43B6B1AFABE35AB3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti6 – 61S → I in BAC28550. (PubMed:16141072)Curated
    Sequence conflicti11 – 111P → S in BAC28550. (PubMed:16141072)Curated
    Sequence conflicti19 – 224PGAS → SGTF in BAC28550. (PubMed:16141072)Curated
    Sequence conflicti30 – 301A → S in BAC28550. (PubMed:16141072)Curated
    Sequence conflicti33 – 353VPA → EPV in BAC28550. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei690 – 6901S → R in isoform Delta. 1 PublicationVSP_012047
    Alternative sequencei691 – 829139Missing in isoform Delta. 1 PublicationVSP_012048Add
    BLAST
    Alternative sequencei784 – 82946GPSAT…QQGPI → ETSRRGDSIPLSKAPSESSA LEECHLALLGSGNDMFSAML PELLSL in isoform Gamma. CuratedVSP_012049Add
    BLAST
    Alternative sequencei784 – 81431GPSAT…GWGFK → VNMATSRLIGAVAGTVLALG VIFGGTGWGIE in isoform Beta. CuratedVSP_012050Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009673 mRNA. Translation: BAA83381.1.
    AK034022 mRNA. Translation: BAC28550.1.
    AL645534 Genomic DNA. Translation: CAI25281.1.
    AL645534, AL645637 Genomic DNA. Translation: CAI25282.1.
    AL645534, AL645637 Genomic DNA. Translation: CAI25284.1.
    AL645637, AL645534 Genomic DNA. Translation: CAI25456.1.
    AL645637, AL645534 Genomic DNA. Translation: CAI25458.1.
    AL683801 Genomic DNA. Translation: CAI26241.1.
    AY545640 mRNA. Translation: AAS49900.1.
    AY545641 mRNA. Translation: AAS49901.1.
    CCDSiCCDS14999.1. [Q9R1V7-1]
    RefSeqiNP_035910.1. NM_011780.2. [Q9R1V7-1]
    XP_006496032.1. XM_006495969.1. [Q9R1V7-2]
    XP_006496033.1. XM_006495970.1. [Q9R1V7-3]
    UniGeneiMm.124892.

    Genome annotation databases

    EnsembliENSMUST00000087374; ENSMUSP00000084633; ENSMUSG00000025964. [Q9R1V7-1]
    ENSMUST00000114107; ENSMUSP00000109742; ENSMUSG00000025964. [Q9R1V7-2]
    GeneIDi23792.
    KEGGimmu:23792.
    UCSCiuc007bge.1. mouse. [Q9R1V7-4]
    uc007bgg.1. mouse. [Q9R1V7-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009673 mRNA. Translation: BAA83381.1 .
    AK034022 mRNA. Translation: BAC28550.1 .
    AL645534 Genomic DNA. Translation: CAI25281.1 .
    AL645534 , AL645637 Genomic DNA. Translation: CAI25282.1 .
    AL645534 , AL645637 Genomic DNA. Translation: CAI25284.1 .
    AL645637 , AL645534 Genomic DNA. Translation: CAI25456.1 .
    AL645637 , AL645534 Genomic DNA. Translation: CAI25458.1 .
    AL683801 Genomic DNA. Translation: CAI26241.1 .
    AY545640 mRNA. Translation: AAS49900.1 .
    AY545641 mRNA. Translation: AAS49901.1 .
    CCDSi CCDS14999.1. [Q9R1V7-1 ]
    RefSeqi NP_035910.1. NM_011780.2. [Q9R1V7-1 ]
    XP_006496032.1. XM_006495969.1. [Q9R1V7-2 ]
    XP_006496033.1. XM_006495970.1. [Q9R1V7-3 ]
    UniGenei Mm.124892.

    3D structure databases

    ProteinModelPortali Q9R1V7.
    SMRi Q9R1V7. Positions 291-770.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204715. 1 interaction.
    IntActi Q9R1V7. 3 interactions.
    MINTi MINT-1177148.
    STRINGi 10090.ENSMUSP00000109738.

    Protein family/group databases

    MEROPSi M12.979.

    PTM databases

    PhosphoSitei Q9R1V7.

    Proteomic databases

    MaxQBi Q9R1V7.
    PaxDbi Q9R1V7.
    PRIDEi Q9R1V7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000087374 ; ENSMUSP00000084633 ; ENSMUSG00000025964 . [Q9R1V7-1 ]
    ENSMUST00000114107 ; ENSMUSP00000109742 ; ENSMUSG00000025964 . [Q9R1V7-2 ]
    GeneIDi 23792.
    KEGGi mmu:23792.
    UCSCi uc007bge.1. mouse. [Q9R1V7-4 ]
    uc007bgg.1. mouse. [Q9R1V7-1 ]

    Organism-specific databases

    CTDi 8745.
    MGIi MGI:1345162. Adam23.

    Phylogenomic databases

    eggNOGi NOG256419.
    GeneTreei ENSGT00680000099751.
    HOGENOMi HOG000231962.
    HOVERGENi HBG050456.
    KOi K06837.

    Miscellaneous databases

    NextBioi 303395.
    PROi Q9R1V7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9R1V7.
    Bgeei Q9R1V7.
    CleanExi MM_ADAM23.
    Genevestigatori Q9R1V7.

    Family and domain databases

    Gene3Di 3.40.390.10. 1 hit.
    4.10.70.10. 1 hit.
    InterProi IPR006586. ADAM_Cys-rich.
    IPR001762. Blood-coag_inhib_Disintegrin.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR024079. MetalloPept_cat_dom.
    IPR001590. Peptidase_M12B.
    IPR002870. Peptidase_M12B_N.
    [Graphical view ]
    Pfami PF08516. ADAM_CR. 1 hit.
    PF00200. Disintegrin. 1 hit.
    PF01562. Pep_M12B_propep. 1 hit.
    PF01421. Reprolysin. 1 hit.
    [Graphical view ]
    SMARTi SM00608. ACR. 1 hit.
    SM00050. DISIN. 1 hit.
    SM00181. EGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57552. SSF57552. 1 hit.
    PROSITEi PS50215. ADAM_MEPRO. 1 hit.
    PS50214. DISINTEGRIN_2. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
      Sagane K., Yamazaki K., Mizui Y., Tanaka I.
      Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DELTA).
      Strain: C57BL/6J.
      Tissue: Diencephalon.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
      Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
      Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE OF 666-829 (ISOFORMS ALPHA; BETA AND GAMMA), DEVELOPMENTAL STAGE.
      Strain: BALB/c.
      Tissue: Brain.
    5. "LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
      Sagane K., Ishihama Y., Sugimoto H.
      Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LGI1 AND LGI4.

    Entry informationi

    Entry nameiADA23_MOUSE
    AccessioniPrimary (citable) accession number: Q9R1V7
    Secondary accession number(s): Q6QDY9, Q6QDZ0, Q8CC33
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 108 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3