Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9R1V7 (ADA23_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 107. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disintegrin and metalloproteinase domain-containing protein 23

Short name=ADAM 23
Alternative name(s):
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Short name=MDC-3
Gene names
Name:Adam23
Synonyms:Mdc3
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length829 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein By similarity.

Subunit structure

Can bind to LGI1 and LGI4.

Subcellular location

Cell membrane; Single-pass type I membrane protein Potential.

Isoform Gamma: Secreted.

Tissue specificity

Brain specific. Ref.1

Developmental stage

On E15 embryo the level of isoform Gamma exceeded that of isoform Alpha and isoform Beta and decreased after birth. On P10 post neonatal, the level of isoform Gamma is undetectable and isoform Alpha and isoform Beta are expressed again. Ref.4

Sequence similarities

Contains 1 disintegrin domain.

Contains 1 EGF-like domain.

Contains 1 peptidase M12B domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform Alpha (identifier: Q9R1V7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Beta (identifier: Q9R1V7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     784-814: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTVLALGVIFGGTGWGIE
Isoform Gamma (identifier: Q9R1V7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     784-829: GPSATNLIIG...RFDPTQQGPI → ETSRRGDSIP...SAMLPELLSL
Isoform Delta (identifier: Q9R1V7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     690-690: S → R
     691-829: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 5555 Potential
Propeptide56 – 283228 Potential
PRO_0000029120
Chain284 – 829546Disintegrin and metalloproteinase domain-containing protein 23
PRO_0000029121

Regions

Topological domain284 – 789506Extracellular Potential
Transmembrane790 – 81021Helical; Potential
Topological domain811 – 82919Cytoplasmic Potential
Domain296 – 493198Peptidase M12B
Domain499 – 58587Disintegrin
Domain729 – 76638EGF-like
Compositional bias586 – 60823Cys-rich

Amino acid modifications

Glycosylation721N-linked (GlcNAc...) Potential
Glycosylation921N-linked (GlcNAc...) Potential
Glycosylation971N-linked (GlcNAc...) Potential
Glycosylation2601N-linked (GlcNAc...) Potential
Glycosylation5441N-linked (GlcNAc...) Potential
Glycosylation5451N-linked (GlcNAc...) Potential
Glycosylation6611N-linked (GlcNAc...) Potential
Glycosylation7291N-linked (GlcNAc...) Potential
Disulfide bond405 ↔ 488 By similarity
Disulfide bond447 ↔ 472 By similarity
Disulfide bond449 ↔ 456 By similarity
Disulfide bond557 ↔ 577 By similarity
Disulfide bond733 ↔ 748 By similarity
Disulfide bond742 ↔ 754 By similarity
Disulfide bond756 ↔ 765 By similarity

Natural variations

Alternative sequence6901S → R in isoform Delta.
VSP_012047
Alternative sequence691 – 829139Missing in isoform Delta.
VSP_012048
Alternative sequence784 – 82946GPSAT…QQGPI → ETSRRGDSIPLSKAPSESSA LEECHLALLGSGNDMFSAML PELLSL in isoform Gamma.
VSP_012049
Alternative sequence784 – 81431GPSAT…GWGFK → VNMATSRLIGAVAGTVLALG VIFGGTGWGIE in isoform Beta.
VSP_012050

Experimental info

Sequence conflict61S → I in BAC28550. Ref.2
Sequence conflict111P → S in BAC28550. Ref.2
Sequence conflict19 – 224PGAS → SGTF in BAC28550. Ref.2
Sequence conflict301A → S in BAC28550. Ref.2
Sequence conflict33 – 353VPA → EPV in BAC28550. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform Alpha [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: F6EBCD69DD50F53A

FASTA82991,548
        10         20         30         40         50         60 
MKPPGSISRR PTLTGCSLPG ASCGPGRCPA GPVPARAPPC RLLLVLLLLP ALATSSRPRA 

        70         80         90        100        110        120 
RGAAAPSAPH WNETAEKTLG VLADEDNTLQ QNSSSRNTSY SSAVQKEITL PSRLVYYINQ 

       130        140        150        160        170        180 
DSESPYHVLD TKARHQQKHN KAVHLAQASF QIEAFGSKFI LDLTLNNGLL SSDYVEIHYE 

       190        200        210        220        230        240 
DGKQMYSKGG EHCYYHGSIR GVKDSRVALS TCNGLHGMFE DDTFVYMIEP LELTDDEKST 

       250        260        270        280        290        300 
GRPHIIQKTL AGQYSKQMKN LSTDGSDQWP LLPELQWLRR RKRAVNPSRG VFEEMKYLEL 

       310        320        330        340        350        360 
MIVNDHKTYK KHRSSHAHTN NFAKSVVNLV DSIYKEQLNT RVVLVAVETW TEKDHIDITI 

       370        380        390        400        410        420 
NPVQMLHDFS KYRQRIKQHA DAVHLISRVT FHYKRSSLSY FGGVCSRIRG VGVNEYGLPM 

       430        440        450        460        470        480 
AVAQVLSQSL AQNLGIQWEP SSRKPKCECI ESWGGCIMEE TGVSHSRKFS KCSILEYRDF 

       490        500        510        520        530        540 
LQRGGGACLF NRPTKLFEPT ECGNGYVEAG EECDCGFHVE CYGVCCKKCS LSNGAHCSDG 

       550        560        570        580        590        600 
PCCNNTSCLF QSRGYECRDA VNSCDITEYC TGDSGQCPPN LHKQDGYSCN QNQGRCYNGE 

       610        620        630        640        650        660 
CKTRDNQCQY IWGTKAAGSD KFCYEKLNTE GTEKGNCGKD GDRWIPCSKH DVFCGFLLCT 

       670        680        690        700        710        720 
NLTRAPRIGQ LQGEIIPTSF YHQGRVIDCS GAHVVLDDDT DVGYVEDGTP CGPSMMCLDR 

       730        740        750        760        770        780 
KCLQIQALNM SSCPLDSRGK VCSGHGVCSN EATCICDFTW AGTDCSIRDP VRNPNPPKDE 

       790        800        810        820 
GPKGPSATNL IIGSIAGAIL VAAIVLGGTG WGFKNVKKRR FDPTQQGPI 

« Hide

Isoform Beta [UniParc].

Checksum: 96C2C8EBC078CF58
Show »

FASTA82991,654
Isoform Gamma [UniParc].

Checksum: FFDA2310B64408E3
Show »

FASTA82991,718
Isoform Delta [UniParc].

Checksum: 43B6B1AFABE35AB3
Show »

FASTA69077,058

References

« Hide 'large scale' references
[1]"Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
Sagane K., Yamazaki K., Mizui Y., Tanaka I.
Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), TISSUE SPECIFICITY.
Tissue: Brain.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DELTA).
Strain: C57BL/6J.
Tissue: Diencephalon.
[3]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[4]"Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE OF 666-829 (ISOFORMS ALPHA; BETA AND GAMMA), DEVELOPMENTAL STAGE.
Strain: BALB/c.
Tissue: Brain.
[5]"LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
Sagane K., Ishihama Y., Sugimoto H.
Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH LGI1 AND LGI4.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB009673 mRNA. Translation: BAA83381.1.
AK034022 mRNA. Translation: BAC28550.1.
AL645534 Genomic DNA. Translation: CAI25281.1.
AL645534, AL645637 Genomic DNA. Translation: CAI25282.1.
AL645534, AL645637 Genomic DNA. Translation: CAI25284.1.
AL645637, AL645534 Genomic DNA. Translation: CAI25456.1.
AL645637, AL645534 Genomic DNA. Translation: CAI25458.1.
AL683801 Genomic DNA. Translation: CAI26241.1.
AY545640 mRNA. Translation: AAS49900.1.
AY545641 mRNA. Translation: AAS49901.1.
CCDSCCDS14999.1. [Q9R1V7-1]
RefSeqNP_035910.1. NM_011780.2. [Q9R1V7-1]
XP_006496032.1. XM_006495969.1. [Q9R1V7-2]
XP_006496033.1. XM_006495970.1. [Q9R1V7-3]
UniGeneMm.124892.

3D structure databases

ProteinModelPortalQ9R1V7.
SMRQ9R1V7. Positions 291-770.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid204715. 1 interaction.
IntActQ9R1V7. 3 interactions.
MINTMINT-1177148.
STRING10090.ENSMUSP00000109738.

Protein family/group databases

MEROPSM12.979.

PTM databases

PhosphoSiteQ9R1V7.

Proteomic databases

MaxQBQ9R1V7.
PaxDbQ9R1V7.
PRIDEQ9R1V7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000087374; ENSMUSP00000084633; ENSMUSG00000025964. [Q9R1V7-1]
ENSMUST00000114107; ENSMUSP00000109742; ENSMUSG00000025964. [Q9R1V7-2]
GeneID23792.
KEGGmmu:23792.
UCSCuc007bge.1. mouse. [Q9R1V7-4]
uc007bgg.1. mouse. [Q9R1V7-1]

Organism-specific databases

CTD8745.
MGIMGI:1345162. Adam23.

Phylogenomic databases

eggNOGNOG256419.
GeneTreeENSGT00680000099751.
HOGENOMHOG000231962.
HOVERGENHBG050456.
KOK06837.

Gene expression databases

ArrayExpressQ9R1V7.
BgeeQ9R1V7.
CleanExMM_ADAM23.
GenevestigatorQ9R1V7.

Family and domain databases

Gene3D3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
SMARTSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMSSF57552. SSF57552. 1 hit.
PROSITEPS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio303395.
PROQ9R1V7.
SOURCESearch...

Entry information

Entry nameADA23_MOUSE
AccessionPrimary (citable) accession number: Q9R1V7
Secondary accession number(s): Q6QDY9, Q6QDZ0, Q8CC33
Entry history
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot