Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9R1V7

- ADA23_MOUSE

UniProt

Q9R1V7 - ADA23_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disintegrin and metalloproteinase domain-containing protein 23

Gene

Adam23

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein (By similarity).By similarity

GO - Molecular functioni

  1. metalloendopeptidase activity Source: InterPro
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Protein family/group databases

MEROPSiM12.979.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 23
Short name:
ADAM 23
Alternative name(s):
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3
Short name:
MDC-3
Gene namesi
Name:Adam23
Synonyms:Mdc3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:1345162. Adam23.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini284 – 789506ExtracellularSequence AnalysisAdd
BLAST
Transmembranei790 – 81021HelicalSequence AnalysisAdd
BLAST
Topological domaini811 – 82919CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 5555Sequence AnalysisAdd
BLAST
Propeptidei56 – 283228Sequence AnalysisPRO_0000029120Add
BLAST
Chaini284 – 829546Disintegrin and metalloproteinase domain-containing protein 23PRO_0000029121Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi72 – 721N-linked (GlcNAc...)Sequence Analysis
Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis
Glycosylationi97 – 971N-linked (GlcNAc...)Sequence Analysis
Glycosylationi260 – 2601N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi405 ↔ 488By similarity
Disulfide bondi447 ↔ 472By similarity
Disulfide bondi449 ↔ 456By similarity
Glycosylationi544 – 5441N-linked (GlcNAc...)Sequence Analysis
Glycosylationi545 – 5451N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi557 ↔ 577By similarity
Glycosylationi661 – 6611N-linked (GlcNAc...)Sequence Analysis
Glycosylationi729 – 7291N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi733 ↔ 748By similarity
Disulfide bondi742 ↔ 754By similarity
Disulfide bondi756 ↔ 765By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9R1V7.
PaxDbiQ9R1V7.
PRIDEiQ9R1V7.

PTM databases

PhosphoSiteiQ9R1V7.

Expressioni

Tissue specificityi

Brain specific.1 Publication

Developmental stagei

On E15 embryo the level of isoform Gamma exceeded that of isoform Alpha and isoform Beta and decreased after birth. On P10 post neonatal, the level of isoform Gamma is undetectable and isoform Alpha and isoform Beta are expressed again.1 Publication

Gene expression databases

BgeeiQ9R1V7.
CleanExiMM_ADAM23.
ExpressionAtlasiQ9R1V7. baseline and differential.
GenevestigatoriQ9R1V7.

Interactioni

Subunit structurei

Can bind to LGI1 and LGI4.

Protein-protein interaction databases

BioGridi204715. 1 interaction.
IntActiQ9R1V7. 3 interactions.
MINTiMINT-1177148.
STRINGi10090.ENSMUSP00000109738.

Structurei

3D structure databases

ProteinModelPortaliQ9R1V7.
SMRiQ9R1V7. Positions 291-770.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini296 – 493198Peptidase M12BPROSITE-ProRule annotationAdd
BLAST
Domaini499 – 58587DisintegrinPROSITE-ProRule annotationAdd
BLAST
Domaini729 – 76638EGF-likePROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi586 – 60823Cys-richAdd
BLAST

Sequence similaritiesi

Contains 1 disintegrin domain.PROSITE-ProRule annotation
Contains 1 EGF-like domain.PROSITE-ProRule annotation
Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256419.
GeneTreeiENSGT00760000119181.
HOGENOMiHOG000231962.
HOVERGENiHBG050456.
InParanoidiQ9R1V7.
KOiK06837.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform Alpha (identifier: Q9R1V7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKPPGSISRR PTLTGCSLPG ASCGPGRCPA GPVPARAPPC RLLLVLLLLP
60 70 80 90 100
ALATSSRPRA RGAAAPSAPH WNETAEKTLG VLADEDNTLQ QNSSSRNTSY
110 120 130 140 150
SSAVQKEITL PSRLVYYINQ DSESPYHVLD TKARHQQKHN KAVHLAQASF
160 170 180 190 200
QIEAFGSKFI LDLTLNNGLL SSDYVEIHYE DGKQMYSKGG EHCYYHGSIR
210 220 230 240 250
GVKDSRVALS TCNGLHGMFE DDTFVYMIEP LELTDDEKST GRPHIIQKTL
260 270 280 290 300
AGQYSKQMKN LSTDGSDQWP LLPELQWLRR RKRAVNPSRG VFEEMKYLEL
310 320 330 340 350
MIVNDHKTYK KHRSSHAHTN NFAKSVVNLV DSIYKEQLNT RVVLVAVETW
360 370 380 390 400
TEKDHIDITI NPVQMLHDFS KYRQRIKQHA DAVHLISRVT FHYKRSSLSY
410 420 430 440 450
FGGVCSRIRG VGVNEYGLPM AVAQVLSQSL AQNLGIQWEP SSRKPKCECI
460 470 480 490 500
ESWGGCIMEE TGVSHSRKFS KCSILEYRDF LQRGGGACLF NRPTKLFEPT
510 520 530 540 550
ECGNGYVEAG EECDCGFHVE CYGVCCKKCS LSNGAHCSDG PCCNNTSCLF
560 570 580 590 600
QSRGYECRDA VNSCDITEYC TGDSGQCPPN LHKQDGYSCN QNQGRCYNGE
610 620 630 640 650
CKTRDNQCQY IWGTKAAGSD KFCYEKLNTE GTEKGNCGKD GDRWIPCSKH
660 670 680 690 700
DVFCGFLLCT NLTRAPRIGQ LQGEIIPTSF YHQGRVIDCS GAHVVLDDDT
710 720 730 740 750
DVGYVEDGTP CGPSMMCLDR KCLQIQALNM SSCPLDSRGK VCSGHGVCSN
760 770 780 790 800
EATCICDFTW AGTDCSIRDP VRNPNPPKDE GPKGPSATNL IIGSIAGAIL
810 820
VAAIVLGGTG WGFKNVKKRR FDPTQQGPI
Length:829
Mass (Da):91,548
Last modified:May 1, 2000 - v1
Checksum:iF6EBCD69DD50F53A
GO
Isoform Beta (identifier: Q9R1V7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     784-814: GPSATNLIIGSIAGAILVAAIVLGGTGWGFK → VNMATSRLIGAVAGTVLALGVIFGGTGWGIE

Show »
Length:829
Mass (Da):91,654
Checksum:i96C2C8EBC078CF58
GO
Isoform Gamma (identifier: Q9R1V7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     784-829: GPSATNLIIG...RFDPTQQGPI → ETSRRGDSIP...SAMLPELLSL

Show »
Length:829
Mass (Da):91,718
Checksum:iFFDA2310B64408E3
GO
Isoform Delta (identifier: Q9R1V7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     690-690: S → R
     691-829: Missing.

Note: No experimental confirmation available.

Show »
Length:690
Mass (Da):77,058
Checksum:i43B6B1AFABE35AB3
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti6 – 61S → I in BAC28550. (PubMed:16141072)Curated
Sequence conflicti11 – 111P → S in BAC28550. (PubMed:16141072)Curated
Sequence conflicti19 – 224PGAS → SGTF in BAC28550. (PubMed:16141072)Curated
Sequence conflicti30 – 301A → S in BAC28550. (PubMed:16141072)Curated
Sequence conflicti33 – 353VPA → EPV in BAC28550. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei690 – 6901S → R in isoform Delta. 1 PublicationVSP_012047
Alternative sequencei691 – 829139Missing in isoform Delta. 1 PublicationVSP_012048Add
BLAST
Alternative sequencei784 – 82946GPSAT…QQGPI → ETSRRGDSIPLSKAPSESSA LEECHLALLGSGNDMFSAML PELLSL in isoform Gamma. CuratedVSP_012049Add
BLAST
Alternative sequencei784 – 81431GPSAT…GWGFK → VNMATSRLIGAVAGTVLALG VIFGGTGWGIE in isoform Beta. CuratedVSP_012050Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009673 mRNA. Translation: BAA83381.1.
AK034022 mRNA. Translation: BAC28550.1.
AL645534 Genomic DNA. Translation: CAI25281.1.
AL645534, AL645637 Genomic DNA. Translation: CAI25282.1.
AL645534, AL645637 Genomic DNA. Translation: CAI25284.1.
AL645637, AL645534 Genomic DNA. Translation: CAI25456.1.
AL645637, AL645534 Genomic DNA. Translation: CAI25458.1.
AL683801 Genomic DNA. Translation: CAI26241.1.
AY545640 mRNA. Translation: AAS49900.1.
AY545641 mRNA. Translation: AAS49901.1.
CCDSiCCDS14999.1. [Q9R1V7-1]
RefSeqiNP_035910.1. NM_011780.2. [Q9R1V7-1]
XP_006496032.1. XM_006495969.1. [Q9R1V7-2]
XP_006496033.1. XM_006495970.1. [Q9R1V7-3]
UniGeneiMm.124892.

Genome annotation databases

EnsembliENSMUST00000087374; ENSMUSP00000084633; ENSMUSG00000025964. [Q9R1V7-1]
ENSMUST00000114103; ENSMUSP00000139862; ENSMUSG00000025964. [Q9R1V7-3]
ENSMUST00000114107; ENSMUSP00000109742; ENSMUSG00000025964. [Q9R1V7-2]
GeneIDi23792.
KEGGimmu:23792.
UCSCiuc007bge.1. mouse. [Q9R1V7-4]
uc007bgg.1. mouse. [Q9R1V7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009673 mRNA. Translation: BAA83381.1 .
AK034022 mRNA. Translation: BAC28550.1 .
AL645534 Genomic DNA. Translation: CAI25281.1 .
AL645534 , AL645637 Genomic DNA. Translation: CAI25282.1 .
AL645534 , AL645637 Genomic DNA. Translation: CAI25284.1 .
AL645637 , AL645534 Genomic DNA. Translation: CAI25456.1 .
AL645637 , AL645534 Genomic DNA. Translation: CAI25458.1 .
AL683801 Genomic DNA. Translation: CAI26241.1 .
AY545640 mRNA. Translation: AAS49900.1 .
AY545641 mRNA. Translation: AAS49901.1 .
CCDSi CCDS14999.1. [Q9R1V7-1 ]
RefSeqi NP_035910.1. NM_011780.2. [Q9R1V7-1 ]
XP_006496032.1. XM_006495969.1. [Q9R1V7-2 ]
XP_006496033.1. XM_006495970.1. [Q9R1V7-3 ]
UniGenei Mm.124892.

3D structure databases

ProteinModelPortali Q9R1V7.
SMRi Q9R1V7. Positions 291-770.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204715. 1 interaction.
IntActi Q9R1V7. 3 interactions.
MINTi MINT-1177148.
STRINGi 10090.ENSMUSP00000109738.

Protein family/group databases

MEROPSi M12.979.

PTM databases

PhosphoSitei Q9R1V7.

Proteomic databases

MaxQBi Q9R1V7.
PaxDbi Q9R1V7.
PRIDEi Q9R1V7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000087374 ; ENSMUSP00000084633 ; ENSMUSG00000025964 . [Q9R1V7-1 ]
ENSMUST00000114103 ; ENSMUSP00000139862 ; ENSMUSG00000025964 . [Q9R1V7-3 ]
ENSMUST00000114107 ; ENSMUSP00000109742 ; ENSMUSG00000025964 . [Q9R1V7-2 ]
GeneIDi 23792.
KEGGi mmu:23792.
UCSCi uc007bge.1. mouse. [Q9R1V7-4 ]
uc007bgg.1. mouse. [Q9R1V7-1 ]

Organism-specific databases

CTDi 8745.
MGIi MGI:1345162. Adam23.

Phylogenomic databases

eggNOGi NOG256419.
GeneTreei ENSGT00760000119181.
HOGENOMi HOG000231962.
HOVERGENi HBG050456.
InParanoidi Q9R1V7.
KOi K06837.

Miscellaneous databases

NextBioi 303395.
PROi Q9R1V7.
SOURCEi Search...

Gene expression databases

Bgeei Q9R1V7.
CleanExi MM_ADAM23.
ExpressionAtlasi Q9R1V7. baseline and differential.
Genevestigatori Q9R1V7.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProi IPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view ]
Pfami PF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view ]
SMARTi SM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57552. SSF57552. 1 hit.
PROSITEi PS50215. ADAM_MEPRO. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
    Sagane K., Yamazaki K., Mizui Y., Tanaka I.
    Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DELTA).
    Strain: C57BL/6J.
    Tissue: Diencephalon.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "Two novel isoforms of Adam23 expressed in the developmental process of mouse and human brains."
    Sun Y.P., Deng K.J., Wang F., Zhang J., Huang X., Qiao S., Zhao S.
    Gene 325:171-178(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE OF 666-829 (ISOFORMS ALPHA; BETA AND GAMMA), DEVELOPMENTAL STAGE.
    Strain: BALB/c.
    Tissue: Brain.
  5. "LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
    Sagane K., Ishihama Y., Sugimoto H.
    Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LGI1 AND LGI4.

Entry informationi

Entry nameiADA23_MOUSE
AccessioniPrimary (citable) accession number: Q9R1V7
Secondary accession number(s): Q6QDY9, Q6QDZ0, Q8CC33
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: May 1, 2000
Last modified: October 29, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3