SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9R1V6

- ADA22_MOUSE

UniProt

Q9R1V6 - ADA22_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Disintegrin and metalloproteinase domain-containing protein 22
Gene
Adam22
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation By similarity. Neuronal receptor for LGI1.1 Publication

GO - Molecular functioni

  1. metalloendopeptidase activity Source: InterPro
  2. protein binding Source: UniProtKB
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. Schwann cell differentiation Source: MGI
  2. adult locomotory behavior Source: MGI
  3. gliogenesis Source: MGI
  4. myelination in peripheral nervous system Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Protein family/group databases

MEROPSiM12.978.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
Gene namesi
Name:Adam22
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:1340046. Adam22.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 734711Extracellular Reviewed prediction
Add
BLAST
Transmembranei735 – 75521Helical; Reviewed prediction
Add
BLAST
Topological domaini756 – 857102Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi509 – 5091D → N: Fails to bind to LGI1. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323 Reviewed prediction
Add
BLAST
Propeptidei24 – 223200 By similarity
PRO_0000029114Add
BLAST
Chaini224 – 904681Disintegrin and metalloproteinase domain-containing protein 22
PRO_0000029115Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi163 – 1631N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi347 ↔ 431 By similarity
Disulfide bondi390 ↔ 415 By similarity
Disulfide bondi392 ↔ 399 By similarity
Disulfide bondi445 ↔ 475 By similarity
Disulfide bondi456 ↔ 472 By similarity
Disulfide bondi458 ↔ 464 By similarity
Disulfide bondi471 ↔ 492 By similarity
Disulfide bondi483 ↔ 489 By similarity
Disulfide bondi488 ↔ 514 By similarity
Disulfide bondi501 ↔ 521 By similarity
Disulfide bondi508 ↔ 540 By similarity
Glycosylationi517 – 5171N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi533 ↔ 545 By similarity
Disulfide bondi552 ↔ 603 By similarity
Disulfide bondi567 ↔ 633 By similarity
Disulfide bondi581 ↔ 591 By similarity
Disulfide bondi598 ↔ 661 By similarity
Glycosylationi632 – 6321N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi655 ↔ 666 By similarity
Glycosylationi673 – 6731N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi677 ↔ 692 By similarity
Disulfide bondi686 ↔ 698 By similarity
Disulfide bondi700 ↔ 709 By similarity
Modified residuei832 – 8321Phosphoserine By similarity

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase By similarity.

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9R1V6.
PaxDbiQ9R1V6.
PRIDEiQ9R1V6.

PTM databases

PhosphoSiteiQ9R1V6.

Expressioni

Tissue specificityi

Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter.1 Publication

Gene expression databases

ArrayExpressiQ9R1V6.
BgeeiQ9R1V6.
CleanExiMM_ADAM22.
GenevestigatoriQ9R1V6.

Interactioni

Subunit structurei

Interacts with LGI1. Can bind to LGI4.2 Publications

Protein-protein interaction databases

IntActiQ9R1V6. 5 interactions.
MINTiMINT-4086922.

Structurei

3D structure databases

ProteinModelPortaliQ9R1V6.
SMRiQ9R1V6. Positions 231-716.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini237 – 436200Peptidase M12B
Add
BLAST
Domaini442 – 52988Disintegrin
Add
BLAST
Domaini673 – 71038EGF-like
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi533 – 666134Cys-rich
Add
BLAST

Sequence similaritiesi

Contains 1 disintegrin domain.
Contains 1 EGF-like domain.

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256419.
GeneTreeiENSGT00680000099751.
HOVERGENiHBG050456.
KOiK16068.
OMAiFSGSQFE.
OrthoDBiEOG7B31M6.
PhylomeDBiQ9R1V6.
TreeFamiTF314733.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR018358. Disintegrin_CS.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSiPR00289. DISINTEGRIN.
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (21)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 21 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9R1V6-3) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G01, 22g

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP    50
LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL 100
DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS 150
TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS 200
EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF 250
KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS 300
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL 350
RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI 400
MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI 450
ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV 500
CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR 550
QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY 600
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE 650
DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC 700
NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI 750
LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK 800
RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR 850
PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW 900
ETSI 904
Length:904
Mass (Da):99,715
Last modified:May 2, 2006 - v2
Checksum:i0FBBD09398EE0B97
GO
Isoform 2 (identifier: Q9R1V6-4) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G03, 22g(D27)

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.

Show »
Length:868
Mass (Da):95,927
Checksum:iC0FA966057D2C5C8
GO
Isoform 3 (identifier: Q9R1V6-5) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G06, 22g(D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.

Show »
Length:862
Mass (Da):95,080
Checksum:i17E4012489871450
GO
Isoform 4 (identifier: Q9R1V6-6) [UniParc]FASTAAdd to Basket

Also known as: ADAM22=G07, 22g(D26D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:899
Mass (Da):98,855
Checksum:iDAFB8A148524416E
GO
Isoform 5 (identifier: Q9R1V6-7) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G08, 22g(D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:905
Mass (Da):99,702
Checksum:i6AAA73D541AFB536
GO
Isoform 6 (identifier: Q9R1V6-8) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G09, 22g+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:941
Mass (Da):103,490
Checksum:iD23B93F0032CBBCF
GO
Isoform 7 (identifier: Q9R1V6-9) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G10, 22g+29.1

The sequence of this isoform differs from the canonical sequence as follows:
     857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT

Show »
Length:862
Mass (Da):95,224
Checksum:i30A066885BBA38FB
GO
Isoform 8 (identifier: Q9R1V6-10) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G11, 22g(D27)+29.5+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR

Show »
Length:907
Mass (Da):100,669
Checksum:iE228AF65D914F778
GO
Isoform 9 (identifier: Q9R1V6-11) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G12, 22g+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:970
Mass (Da):107,122
Checksum:iABBCD4AD024F349B
GO
Isoform 10 (identifier: Q9R1V6-12) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G17, 22G[27L]+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR

Show »
Length:980
Mass (Da):107,831
Checksum:i45BE20975A1D5820
GO
Isoform 11 (identifier: Q9R1V6-13) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G18, 22g(D26)[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:927
Mass (Da):102,129
Checksum:iBD4C6B317C47EFAB
GO
Isoform 12 (identifier: Q9R1V6-14) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G19, 22g[27L]+29.5

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:962
Mass (Da):106,608
Checksum:iD77057A06FD2A7E4
GO
Isoform 13 (identifier: Q9R1V6-15) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G20, 22g[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:933
Mass (Da):102,976
Checksum:i1052AC188694EDFC
GO
Isoform 14 (identifier: Q9R1V6-16) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G21, 22g(D26)[27S]

The sequence of this isoform differs from the canonical sequence as follows:
     760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF

Show »
Length:883
Mass (Da):97,640
Checksum:iC3A2C695E08B72F9
GO
Isoform 15 (identifier: Q9R1V6-17) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G22, 22g(D27)+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → DSQDGPHQQDR

Show »
Length:878
Mass (Da):97,062
Checksum:i251D63D6D6CAF0A3
GO
Isoform 16 (identifier: Q9R1V6-18) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G23, 22g(D25D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF

Show »
Length:832
Mass (Da):92,271
Checksum:i6BB6F0B5CA150F28
GO
Isoform 17 (identifier: Q9R1V6-2) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A05, Beta

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     858-904: Missing.

Show »
Length:821
Mass (Da):90,952
Checksum:i4F8F12B425EB683C
GO
Isoform 18 (identifier: Q9R1V6-19) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A13

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     858-904: Missing.

Show »
Length:815
Mass (Da):90,105
Checksum:i59F2A397E25E283F
GO
Isoform 19 (identifier: Q9R1V6-20) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A15

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     858-904: Missing.

Show »
Length:851
Mass (Da):93,893
Checksum:iB1A6A8713614459E
GO
Isoform 20 (identifier: Q9R1V6-1) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A04, Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     858-904: Missing.

Show »
Length:857
Mass (Da):94,740
Checksum:iCB88FB7000208E09
GO
Isoform 21 (identifier: Q9R1V6-21) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A16

The sequence of this isoform differs from the canonical sequence as follows:
     766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
     847-904: Missing.

Show »
Length:846
Mass (Da):93,592
Checksum:i08A647F010B67028
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei730 – 904175VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16.
VSP_018233Add
BLAST
Alternative sequencei760 – 904145NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14.
VSP_018234Add
BLAST
Alternative sequencei760 – 80142Missing in isoform 3, isoform 4 and isoform 18.
VSP_018235Add
BLAST
Alternative sequencei760 – 7656Missing in isoform 11 and isoform 19.
VSP_018236
Alternative sequencei766 – 84681QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21.
VSP_018237Add
BLAST
Alternative sequencei766 – 80136Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17.
VSP_018238Add
BLAST
Alternative sequencei802 – 8021S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13.
VSP_018239
Alternative sequencei847 – 90458Missing in isoform 21.
VSP_018240Add
BLAST
Alternative sequencei857 – 90448ETLSP…WETSI → DLGIIT in isoform 7.
VSP_018241Add
BLAST
Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10.
VSP_018242
Alternative sequencei857 – 8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12.
VSP_018243
Alternative sequencei857 – 8571E → DSQDGPHQQDR in isoform 15.
VSP_018244
Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6.
VSP_018245
Alternative sequencei857 – 8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8.
VSP_018246
Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9.
VSP_018247
Alternative sequencei858 – 90447Missing in isoform 17, isoform 18, isoform 19 and isoform 20.
VSP_018248Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti639 – 6391K → R in BAC28742. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009674 mRNA. Translation: BAA83382.1.
AB009674 mRNA. Translation: BAA83383.1.
AK034528 mRNA. Translation: BAC28742.1.
AB179842 mRNA. Translation: BAD72803.1.
AB179843 mRNA. Translation: BAD72804.1.
AB179844 mRNA. Translation: BAD72805.1.
AB179845 mRNA. Translation: BAD72806.1.
AB179846 mRNA. Translation: BAD72807.1.
AB179847 mRNA. Translation: BAD72808.1.
AB179848 mRNA. Translation: BAD72809.1.
AB179849 mRNA. Translation: BAD72810.1.
AB179850 mRNA. Translation: BAD72811.1.
AB179851 mRNA. Translation: BAD72812.1.
AB179852 mRNA. Translation: BAD72813.1.
AB179853 mRNA. Translation: BAD72814.1.
AB179854 mRNA. Translation: BAD72815.1.
AB179855 mRNA. Translation: BAD72816.1.
AB179856 mRNA. Translation: BAD72817.1.
AB179857 mRNA. Translation: BAD72818.1.
AB179858 mRNA. Translation: BAD72819.1.
AB179859 mRNA. Translation: BAD72820.1.
AB179860 mRNA. Translation: BAD72821.1.
AB179861 mRNA. Translation: BAD72822.1.
AB179862 mRNA. Translation: BAD72823.1.
CCDSiCCDS19080.1. [Q9R1V6-1]
CCDS51411.1. [Q9R1V6-4]
RefSeqiNP_001007221.1. NM_001007220.2. [Q9R1V6-1]
NP_001007222.1. NM_001007221.2. [Q9R1V6-2]
NP_001091695.1. NM_001098225.1. [Q9R1V6-4]
XP_006503592.1. XM_006503529.1. [Q9R1V6-12]
XP_006503593.1. XM_006503530.1. [Q9R1V6-11]
XP_006503594.1. XM_006503531.1. [Q9R1V6-14]
XP_006503596.1. XM_006503533.1. [Q9R1V6-8]
XP_006503598.1. XM_006503535.1. [Q9R1V6-15]
XP_006503600.1. XM_006503537.1. [Q9R1V6-7]
XP_006503601.1. XM_006503538.1. [Q9R1V6-3]
XP_006503602.1. XM_006503539.1. [Q9R1V6-6]
XP_006503605.1. XM_006503542.1. [Q9R1V6-5]
UniGeneiMm.275895.

Genome annotation databases

EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. [Q9R1V6-6]
GeneIDi11496.
KEGGimmu:11496.
UCSCiuc008wjk.2. mouse. [Q9R1V6-3]
uc008wjv.1. mouse. [Q9R1V6-4]
uc008wjy.1. mouse. [Q9R1V6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009674 mRNA. Translation: BAA83382.1 .
AB009674 mRNA. Translation: BAA83383.1 .
AK034528 mRNA. Translation: BAC28742.1 .
AB179842 mRNA. Translation: BAD72803.1 .
AB179843 mRNA. Translation: BAD72804.1 .
AB179844 mRNA. Translation: BAD72805.1 .
AB179845 mRNA. Translation: BAD72806.1 .
AB179846 mRNA. Translation: BAD72807.1 .
AB179847 mRNA. Translation: BAD72808.1 .
AB179848 mRNA. Translation: BAD72809.1 .
AB179849 mRNA. Translation: BAD72810.1 .
AB179850 mRNA. Translation: BAD72811.1 .
AB179851 mRNA. Translation: BAD72812.1 .
AB179852 mRNA. Translation: BAD72813.1 .
AB179853 mRNA. Translation: BAD72814.1 .
AB179854 mRNA. Translation: BAD72815.1 .
AB179855 mRNA. Translation: BAD72816.1 .
AB179856 mRNA. Translation: BAD72817.1 .
AB179857 mRNA. Translation: BAD72818.1 .
AB179858 mRNA. Translation: BAD72819.1 .
AB179859 mRNA. Translation: BAD72820.1 .
AB179860 mRNA. Translation: BAD72821.1 .
AB179861 mRNA. Translation: BAD72822.1 .
AB179862 mRNA. Translation: BAD72823.1 .
CCDSi CCDS19080.1. [Q9R1V6-1 ]
CCDS51411.1. [Q9R1V6-4 ]
RefSeqi NP_001007221.1. NM_001007220.2. [Q9R1V6-1 ]
NP_001007222.1. NM_001007221.2. [Q9R1V6-2 ]
NP_001091695.1. NM_001098225.1. [Q9R1V6-4 ]
XP_006503592.1. XM_006503529.1. [Q9R1V6-12 ]
XP_006503593.1. XM_006503530.1. [Q9R1V6-11 ]
XP_006503594.1. XM_006503531.1. [Q9R1V6-14 ]
XP_006503596.1. XM_006503533.1. [Q9R1V6-8 ]
XP_006503598.1. XM_006503535.1. [Q9R1V6-15 ]
XP_006503600.1. XM_006503537.1. [Q9R1V6-7 ]
XP_006503601.1. XM_006503538.1. [Q9R1V6-3 ]
XP_006503602.1. XM_006503539.1. [Q9R1V6-6 ]
XP_006503605.1. XM_006503542.1. [Q9R1V6-5 ]
UniGenei Mm.275895.

3D structure databases

ProteinModelPortali Q9R1V6.
SMRi Q9R1V6. Positions 231-716.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9R1V6. 5 interactions.
MINTi MINT-4086922.

Protein family/group databases

MEROPSi M12.978.

PTM databases

PhosphoSitei Q9R1V6.

Proteomic databases

MaxQBi Q9R1V6.
PaxDbi Q9R1V6.
PRIDEi Q9R1V6.

Protocols and materials databases

DNASUi 11496.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000046838 ; ENSMUSP00000049120 ; ENSMUSG00000040537 . [Q9R1V6-1 ]
ENSMUST00000050166 ; ENSMUSP00000055000 ; ENSMUSG00000040537 . [Q9R1V6-4 ]
ENSMUST00000088744 ; ENSMUSP00000086122 ; ENSMUSG00000040537 . [Q9R1V6-13 ]
ENSMUST00000088761 ; ENSMUSP00000086139 ; ENSMUSG00000040537 . [Q9R1V6-3 ]
ENSMUST00000115388 ; ENSMUSP00000111046 ; ENSMUSG00000040537 . [Q9R1V6-6 ]
GeneIDi 11496.
KEGGi mmu:11496.
UCSCi uc008wjk.2. mouse. [Q9R1V6-3 ]
uc008wjv.1. mouse. [Q9R1V6-4 ]
uc008wjy.1. mouse. [Q9R1V6-2 ]

Organism-specific databases

CTDi 53616.
MGIi MGI:1340046. Adam22.

Phylogenomic databases

eggNOGi NOG256419.
GeneTreei ENSGT00680000099751.
HOVERGENi HBG050456.
KOi K16068.
OMAi FSGSQFE.
OrthoDBi EOG7B31M6.
PhylomeDBi Q9R1V6.
TreeFami TF314733.

Miscellaneous databases

NextBioi 278878.
PROi Q9R1V6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9R1V6.
Bgeei Q9R1V6.
CleanExi MM_ADAM22.
Genevestigatori Q9R1V6.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProi IPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR018358. Disintegrin_CS.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view ]
Pfami PF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view ]
PRINTSi PR00289. DISINTEGRIN.
SMARTi SM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57552. SSF57552. 1 hit.
PROSITEi PS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
    Sagane K., Yamazaki K., Mizui Y., Tanaka I.
    Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 17 AND 20).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 619-904 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Embryo.
  3. "Ataxia and peripheral nerve hypomyelination in ADAM22-deficient mice."
    Sagane K., Hayakawa K., Kai J., Hirohashi T., Takahashi E., Miyamoto N., Ino M., Oki T., Yamazaki K., Nagasu T.
    BMC Neurosci. 6:33-33(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-904 (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20 AND 21), TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
  4. "Epilepsy-related ligand/receptor complex LGI1 and ADAM22 regulate synaptic transmission."
    Fukata Y., Adesnik H., Iwanaga T., Bredt D.S., Nicoll R.A., Fukata M.
    Science 313:1792-1795(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH LGI1, MUTAGENESIS OF ASP-509.
  5. "LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
    Sagane K., Ishihama Y., Sugimoto H.
    Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LIGI1 AND LGI4.

Entry informationi

Entry nameiADA22_MOUSE
AccessioniPrimary (citable) accession number: Q9R1V6
Secondary accession number(s): Q5TLI8
, Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 2, 2006
Last modified: July 9, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi