Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9R1V6

- ADA22_MOUSE

UniProt

Q9R1V6 - ADA22_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

Adam22

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation By similarity. Neuronal receptor for LGI1.By similarity1 Publication

GO - Molecular functioni

  1. metalloendopeptidase activity Source: InterPro
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. adult locomotory behavior Source: MGI
  2. gliogenesis Source: MGI
  3. myelination in peripheral nervous system Source: MGI
  4. Schwann cell differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Protein family/group databases

MEROPSiM12.978.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
Gene namesi
Name:Adam22
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 5

Organism-specific databases

MGIiMGI:1340046. Adam22.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves.1 Publication

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi509 – 5091D → N: Fails to bind to LGI1. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Propeptidei24 – 223200By similarityPRO_0000029114Add
BLAST
Chaini224 – 904681Disintegrin and metalloproteinase domain-containing protein 22PRO_0000029115Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi347 ↔ 431By similarity
Disulfide bondi390 ↔ 415By similarity
Disulfide bondi392 ↔ 399By similarity
Disulfide bondi445 ↔ 475By similarity
Disulfide bondi456 ↔ 472By similarity
Disulfide bondi458 ↔ 464By similarity
Disulfide bondi471 ↔ 492By similarity
Disulfide bondi483 ↔ 489By similarity
Disulfide bondi488 ↔ 514By similarity
Disulfide bondi501 ↔ 521By similarity
Disulfide bondi508 ↔ 540By similarity
Glycosylationi517 – 5171N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi533 ↔ 545By similarity
Disulfide bondi552 ↔ 603By similarity
Disulfide bondi567 ↔ 633By similarity
Disulfide bondi581 ↔ 591By similarity
Disulfide bondi598 ↔ 661By similarity
Glycosylationi632 – 6321N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi655 ↔ 666By similarity
Glycosylationi673 – 6731N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi677 ↔ 692By similarity
Disulfide bondi686 ↔ 698By similarity
Disulfide bondi700 ↔ 709By similarity
Modified residuei832 – 8321PhosphoserineBy similarity

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9R1V6.
PaxDbiQ9R1V6.
PRIDEiQ9R1V6.

PTM databases

PhosphoSiteiQ9R1V6.

Expressioni

Tissue specificityi

Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter.1 Publication

Gene expression databases

BgeeiQ9R1V6.
CleanExiMM_ADAM22.
ExpressionAtlasiQ9R1V6. baseline and differential.
GenevestigatoriQ9R1V6.

Interactioni

Subunit structurei

Interacts with LGI1. Can bind to LGI4.2 Publications

Protein-protein interaction databases

IntActiQ9R1V6. 5 interactions.
MINTiMINT-4086922.

Structurei

3D structure databases

ProteinModelPortaliQ9R1V6.
SMRiQ9R1V6. Positions 231-716.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini24 – 734711ExtracellularSequence AnalysisAdd
BLAST
Topological domaini756 – 857102CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei735 – 75521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini237 – 436200Peptidase M12BPROSITE-ProRule annotationAdd
BLAST
Domaini442 – 52988DisintegrinPROSITE-ProRule annotationAdd
BLAST
Domaini673 – 71038EGF-likePROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi533 – 666134Cys-richAdd
BLAST

Sequence similaritiesi

Contains 1 disintegrin domain.PROSITE-ProRule annotation
Contains 1 EGF-like domain.PROSITE-ProRule annotation
Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG256419.
GeneTreeiENSGT00760000119181.
HOVERGENiHBG050456.
InParanoidiQ9R1V6.
KOiK16068.
OMAiFSGSQFE.
OrthoDBiEOG7B31M6.
PhylomeDBiQ9R1V6.
TreeFamiTF314733.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR018358. Disintegrin_CS.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSiPR00289. DISINTEGRIN.
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (21)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 21 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9R1V6-3) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G01, 22g

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP
60 70 80 90 100
LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL
110 120 130 140 150
DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS
160 170 180 190 200
TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS
210 220 230 240 250
EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF
260 270 280 290 300
KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS
310 320 330 340 350
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL
360 370 380 390 400
RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI
410 420 430 440 450
MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI
460 470 480 490 500
ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV
510 520 530 540 550
CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR
560 570 580 590 600
QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY
610 620 630 640 650
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE
660 670 680 690 700
DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC
710 720 730 740 750
NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI
760 770 780 790 800
LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK
810 820 830 840 850
RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR
860 870 880 890 900
PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW

ETSI
Length:904
Mass (Da):99,715
Last modified:May 2, 2006 - v2
Checksum:i0FBBD09398EE0B97
GO
Isoform 2 (identifier: Q9R1V6-4) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G03, 22g(D27)

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.

Show »
Length:868
Mass (Da):95,927
Checksum:iC0FA966057D2C5C8
GO
Isoform 3 (identifier: Q9R1V6-5) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G06, 22g(D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.

Show »
Length:862
Mass (Da):95,080
Checksum:i17E4012489871450
GO
Isoform 4 (identifier: Q9R1V6-6) [UniParc]FASTAAdd to Basket

Also known as: ADAM22=G07, 22g(D26D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:899
Mass (Da):98,855
Checksum:iDAFB8A148524416E
GO
Isoform 5 (identifier: Q9R1V6-7) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G08, 22g(D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:905
Mass (Da):99,702
Checksum:i6AAA73D541AFB536
GO
Isoform 6 (identifier: Q9R1V6-8) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G09, 22g+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:941
Mass (Da):103,490
Checksum:iD23B93F0032CBBCF
GO
Isoform 7 (identifier: Q9R1V6-9) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G10, 22g+29.1

The sequence of this isoform differs from the canonical sequence as follows:
     857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT

Show »
Length:862
Mass (Da):95,224
Checksum:i30A066885BBA38FB
GO
Isoform 8 (identifier: Q9R1V6-10) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G11, 22g(D27)+29.5+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR

Show »
Length:907
Mass (Da):100,669
Checksum:iE228AF65D914F778
GO
Isoform 9 (identifier: Q9R1V6-11) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G12, 22g+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:970
Mass (Da):107,122
Checksum:iABBCD4AD024F349B
GO
Isoform 10 (identifier: Q9R1V6-12) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G17, 22G[27L]+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR

Show »
Length:980
Mass (Da):107,831
Checksum:i45BE20975A1D5820
GO
Isoform 11 (identifier: Q9R1V6-13) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G18, 22g(D26)[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:927
Mass (Da):102,129
Checksum:iBD4C6B317C47EFAB
GO
Isoform 12 (identifier: Q9R1V6-14) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G19, 22g[27L]+29.5

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:962
Mass (Da):106,608
Checksum:iD77057A06FD2A7E4
GO
Isoform 13 (identifier: Q9R1V6-15) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G20, 22g[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:933
Mass (Da):102,976
Checksum:i1052AC188694EDFC
GO
Isoform 14 (identifier: Q9R1V6-16) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G21, 22g(D26)[27S]

The sequence of this isoform differs from the canonical sequence as follows:
     760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF

Show »
Length:883
Mass (Da):97,640
Checksum:iC3A2C695E08B72F9
GO
Isoform 15 (identifier: Q9R1V6-17) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G22, 22g(D27)+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → DSQDGPHQQDR

Show »
Length:878
Mass (Da):97,062
Checksum:i251D63D6D6CAF0A3
GO
Isoform 16 (identifier: Q9R1V6-18) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-G23, 22g(D25D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF

Show »
Length:832
Mass (Da):92,271
Checksum:i6BB6F0B5CA150F28
GO
Isoform 17 (identifier: Q9R1V6-2) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A05, Beta

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     858-904: Missing.

Show »
Length:821
Mass (Da):90,952
Checksum:i4F8F12B425EB683C
GO
Isoform 18 (identifier: Q9R1V6-19) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A13

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     858-904: Missing.

Show »
Length:815
Mass (Da):90,105
Checksum:i59F2A397E25E283F
GO
Isoform 19 (identifier: Q9R1V6-20) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A15

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     858-904: Missing.

Show »
Length:851
Mass (Da):93,893
Checksum:iB1A6A8713614459E
GO
Isoform 20 (identifier: Q9R1V6-1) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A04, Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     858-904: Missing.

Show »
Length:857
Mass (Da):94,740
Checksum:iCB88FB7000208E09
GO
Isoform 21 (identifier: Q9R1V6-21) [UniParc]FASTAAdd to Basket

Also known as: ADAM22-A16

The sequence of this isoform differs from the canonical sequence as follows:
     766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
     847-904: Missing.

Show »
Length:846
Mass (Da):93,592
Checksum:i08A647F010B67028
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti639 – 6391K → R in BAC28742. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei730 – 904175VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16. 1 PublicationVSP_018233Add
BLAST
Alternative sequencei760 – 904145NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14. 1 PublicationVSP_018234Add
BLAST
Alternative sequencei760 – 80142Missing in isoform 3, isoform 4 and isoform 18. 1 PublicationVSP_018235Add
BLAST
Alternative sequencei760 – 7656Missing in isoform 11 and isoform 19. 1 PublicationVSP_018236
Alternative sequencei766 – 84681QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21. 1 PublicationVSP_018237Add
BLAST
Alternative sequencei766 – 80136Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17. 3 PublicationsVSP_018238Add
BLAST
Alternative sequencei802 – 8021S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13. 1 PublicationVSP_018239
Alternative sequencei847 – 90458Missing in isoform 21. 1 PublicationVSP_018240Add
BLAST
Alternative sequencei857 – 90448ETLSP…WETSI → DLGIIT in isoform 7. 1 PublicationVSP_018241Add
BLAST
Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10. 1 PublicationVSP_018242
Alternative sequencei857 – 8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12. 1 PublicationVSP_018243
Alternative sequencei857 – 8571E → DSQDGPHQQDR in isoform 15. 1 PublicationVSP_018244
Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6. 1 PublicationVSP_018245
Alternative sequencei857 – 8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8. 1 PublicationVSP_018246
Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9. 1 PublicationVSP_018247
Alternative sequencei858 – 90447Missing in isoform 17, isoform 18, isoform 19 and isoform 20. 2 PublicationsVSP_018248Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009674 mRNA. Translation: BAA83382.1.
AB009674 mRNA. Translation: BAA83383.1.
AK034528 mRNA. Translation: BAC28742.1.
AB179842 mRNA. Translation: BAD72803.1.
AB179843 mRNA. Translation: BAD72804.1.
AB179844 mRNA. Translation: BAD72805.1.
AB179845 mRNA. Translation: BAD72806.1.
AB179846 mRNA. Translation: BAD72807.1.
AB179847 mRNA. Translation: BAD72808.1.
AB179848 mRNA. Translation: BAD72809.1.
AB179849 mRNA. Translation: BAD72810.1.
AB179850 mRNA. Translation: BAD72811.1.
AB179851 mRNA. Translation: BAD72812.1.
AB179852 mRNA. Translation: BAD72813.1.
AB179853 mRNA. Translation: BAD72814.1.
AB179854 mRNA. Translation: BAD72815.1.
AB179855 mRNA. Translation: BAD72816.1.
AB179856 mRNA. Translation: BAD72817.1.
AB179857 mRNA. Translation: BAD72818.1.
AB179858 mRNA. Translation: BAD72819.1.
AB179859 mRNA. Translation: BAD72820.1.
AB179860 mRNA. Translation: BAD72821.1.
AB179861 mRNA. Translation: BAD72822.1.
AB179862 mRNA. Translation: BAD72823.1.
CCDSiCCDS19080.1. [Q9R1V6-1]
CCDS51411.1. [Q9R1V6-4]
RefSeqiNP_001007221.1. NM_001007220.2. [Q9R1V6-1]
NP_001007222.1. NM_001007221.2. [Q9R1V6-2]
NP_001091695.1. NM_001098225.1. [Q9R1V6-4]
XP_006503592.1. XM_006503529.1. [Q9R1V6-12]
XP_006503593.1. XM_006503530.1. [Q9R1V6-11]
XP_006503594.1. XM_006503531.1. [Q9R1V6-14]
XP_006503596.1. XM_006503533.1. [Q9R1V6-8]
XP_006503598.1. XM_006503535.1. [Q9R1V6-15]
XP_006503600.1. XM_006503537.1. [Q9R1V6-7]
XP_006503601.1. XM_006503538.1. [Q9R1V6-3]
XP_006503602.1. XM_006503539.1. [Q9R1V6-6]
XP_006503605.1. XM_006503542.1. [Q9R1V6-5]
UniGeneiMm.275895.

Genome annotation databases

EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. [Q9R1V6-6]
GeneIDi11496.
KEGGimmu:11496.
UCSCiuc008wjk.2. mouse. [Q9R1V6-3]
uc008wjv.1. mouse. [Q9R1V6-4]
uc008wjy.1. mouse. [Q9R1V6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB009674 mRNA. Translation: BAA83382.1 .
AB009674 mRNA. Translation: BAA83383.1 .
AK034528 mRNA. Translation: BAC28742.1 .
AB179842 mRNA. Translation: BAD72803.1 .
AB179843 mRNA. Translation: BAD72804.1 .
AB179844 mRNA. Translation: BAD72805.1 .
AB179845 mRNA. Translation: BAD72806.1 .
AB179846 mRNA. Translation: BAD72807.1 .
AB179847 mRNA. Translation: BAD72808.1 .
AB179848 mRNA. Translation: BAD72809.1 .
AB179849 mRNA. Translation: BAD72810.1 .
AB179850 mRNA. Translation: BAD72811.1 .
AB179851 mRNA. Translation: BAD72812.1 .
AB179852 mRNA. Translation: BAD72813.1 .
AB179853 mRNA. Translation: BAD72814.1 .
AB179854 mRNA. Translation: BAD72815.1 .
AB179855 mRNA. Translation: BAD72816.1 .
AB179856 mRNA. Translation: BAD72817.1 .
AB179857 mRNA. Translation: BAD72818.1 .
AB179858 mRNA. Translation: BAD72819.1 .
AB179859 mRNA. Translation: BAD72820.1 .
AB179860 mRNA. Translation: BAD72821.1 .
AB179861 mRNA. Translation: BAD72822.1 .
AB179862 mRNA. Translation: BAD72823.1 .
CCDSi CCDS19080.1. [Q9R1V6-1 ]
CCDS51411.1. [Q9R1V6-4 ]
RefSeqi NP_001007221.1. NM_001007220.2. [Q9R1V6-1 ]
NP_001007222.1. NM_001007221.2. [Q9R1V6-2 ]
NP_001091695.1. NM_001098225.1. [Q9R1V6-4 ]
XP_006503592.1. XM_006503529.1. [Q9R1V6-12 ]
XP_006503593.1. XM_006503530.1. [Q9R1V6-11 ]
XP_006503594.1. XM_006503531.1. [Q9R1V6-14 ]
XP_006503596.1. XM_006503533.1. [Q9R1V6-8 ]
XP_006503598.1. XM_006503535.1. [Q9R1V6-15 ]
XP_006503600.1. XM_006503537.1. [Q9R1V6-7 ]
XP_006503601.1. XM_006503538.1. [Q9R1V6-3 ]
XP_006503602.1. XM_006503539.1. [Q9R1V6-6 ]
XP_006503605.1. XM_006503542.1. [Q9R1V6-5 ]
UniGenei Mm.275895.

3D structure databases

ProteinModelPortali Q9R1V6.
SMRi Q9R1V6. Positions 231-716.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9R1V6. 5 interactions.
MINTi MINT-4086922.

Protein family/group databases

MEROPSi M12.978.

PTM databases

PhosphoSitei Q9R1V6.

Proteomic databases

MaxQBi Q9R1V6.
PaxDbi Q9R1V6.
PRIDEi Q9R1V6.

Protocols and materials databases

DNASUi 11496.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000046838 ; ENSMUSP00000049120 ; ENSMUSG00000040537 . [Q9R1V6-1 ]
ENSMUST00000050166 ; ENSMUSP00000055000 ; ENSMUSG00000040537 . [Q9R1V6-4 ]
ENSMUST00000088744 ; ENSMUSP00000086122 ; ENSMUSG00000040537 . [Q9R1V6-13 ]
ENSMUST00000088761 ; ENSMUSP00000086139 ; ENSMUSG00000040537 . [Q9R1V6-3 ]
ENSMUST00000115388 ; ENSMUSP00000111046 ; ENSMUSG00000040537 . [Q9R1V6-6 ]
GeneIDi 11496.
KEGGi mmu:11496.
UCSCi uc008wjk.2. mouse. [Q9R1V6-3 ]
uc008wjv.1. mouse. [Q9R1V6-4 ]
uc008wjy.1. mouse. [Q9R1V6-2 ]

Organism-specific databases

CTDi 53616.
MGIi MGI:1340046. Adam22.

Phylogenomic databases

eggNOGi NOG256419.
GeneTreei ENSGT00760000119181.
HOVERGENi HBG050456.
InParanoidi Q9R1V6.
KOi K16068.
OMAi FSGSQFE.
OrthoDBi EOG7B31M6.
PhylomeDBi Q9R1V6.
TreeFami TF314733.

Miscellaneous databases

NextBioi 278878.
PROi Q9R1V6.
SOURCEi Search...

Gene expression databases

Bgeei Q9R1V6.
CleanExi MM_ADAM22.
ExpressionAtlasi Q9R1V6. baseline and differential.
Genevestigatori Q9R1V6.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProi IPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR018358. Disintegrin_CS.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view ]
Pfami PF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view ]
PRINTSi PR00289. DISINTEGRIN.
SMARTi SM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57552. SSF57552. 1 hit.
PROSITEi PS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
    Sagane K., Yamazaki K., Mizui Y., Tanaka I.
    Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 17 AND 20).
    Tissue: Brain.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 619-904 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Embryo.
  3. "Ataxia and peripheral nerve hypomyelination in ADAM22-deficient mice."
    Sagane K., Hayakawa K., Kai J., Hirohashi T., Takahashi E., Miyamoto N., Ino M., Oki T., Yamazaki K., Nagasu T.
    BMC Neurosci. 6:33-33(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-904 (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20 AND 21), TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
  4. "Epilepsy-related ligand/receptor complex LGI1 and ADAM22 regulate synaptic transmission."
    Fukata Y., Adesnik H., Iwanaga T., Bredt D.S., Nicoll R.A., Fukata M.
    Science 313:1792-1795(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH LGI1, MUTAGENESIS OF ASP-509.
  5. "LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
    Sagane K., Ishihama Y., Sugimoto H.
    Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LIGI1 AND LGI4.

Entry informationi

Entry nameiADA22_MOUSE
AccessioniPrimary (citable) accession number: Q9R1V6
Secondary accession number(s): Q5TLI8
, Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 2, 2006
Last modified: October 29, 2014
This is version 126 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3