Q9R1V6 (ADA22_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 18, 2012.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 22 Short name=ADAM 22 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 904 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation By similarity. Neuronal receptor for LGI1. Ref.4 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter. Ref.3 |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. |
| Disruption phenotype | Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves. Ref.3 |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | EGF-like domain Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | adult locomotory behavior Inferred from mutant phenotype Ref.3. Source: MGI myelination in peripheral nervous systemInferred from mutant phenotype Ref.3. Source: MGI proteolysisInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | metalloendopeptidase activity Inferred from electronic annotation. Source: InterPro protein bindingInferred from physical interaction Ref.6. Source: UniProtKB receptor activityInferred from electronic annotation. Source: UniProtKB-KW zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 21 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9R1V6-3) Also known as: ADAM22-G01; 22g; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9R1V6-4) Also known as: ADAM22-G03; 22g(D27); The sequence of this isoform differs from the canonical sequence as follows: 766-801: Missing. | ||||||
| Isoform 3 (identifier: Q9R1V6-5) Also known as: ADAM22-G06; 22g(D26D27); The sequence of this isoform differs from the canonical sequence as follows: 760-801: Missing. | ||||||
| Isoform 4 (identifier: Q9R1V6-6) Also known as: ADAM22=G07; 22g(D26D27)+29.3; The sequence of this isoform differs from the canonical sequence as follows: 760-801: Missing. 857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR | ||||||
| Isoform 5 (identifier: Q9R1V6-7) Also known as: ADAM22-G08; 22g(D27)+29.3; The sequence of this isoform differs from the canonical sequence as follows: 766-801: Missing. 857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR | ||||||
| Isoform 6 (identifier: Q9R1V6-8) Also known as: ADAM22-G09; 22g+29.3; The sequence of this isoform differs from the canonical sequence as follows: 857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR | ||||||
| Isoform 7 (identifier: Q9R1V6-9) Also known as: ADAM22-G10; 22g+29.1; The sequence of this isoform differs from the canonical sequence as follows: 857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT | ||||||
| Isoform 8 (identifier: Q9R1V6-10) Also known as: ADAM22-G11; 22g(D27)+29.5+29.7; The sequence of this isoform differs from the canonical sequence as follows: 766-801: Missing. 857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR | ||||||
| Isoform 9 (identifier: Q9R1V6-11) Also known as: ADAM22-G12; 22g+29.3+29.7; The sequence of this isoform differs from the canonical sequence as follows: 857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR | ||||||
| Isoform 10 (identifier: Q9R1V6-12) Also known as: ADAM22-G17; 22G[27L]+29.3+29.7; The sequence of this isoform differs from the canonical sequence as follows: 802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS 857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR | ||||||
| Isoform 11 (identifier: Q9R1V6-13) Also known as: ADAM22-G18; 22g(D26)[27L]; The sequence of this isoform differs from the canonical sequence as follows: 760-765: Missing. 802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS | ||||||
| Isoform 12 (identifier: Q9R1V6-14) Also known as: ADAM22-G19; 22g[27L]+29.5; The sequence of this isoform differs from the canonical sequence as follows: 802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS 857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR | ||||||
| Isoform 13 (identifier: Q9R1V6-15) Also known as: ADAM22-G20; 22g[27L]; The sequence of this isoform differs from the canonical sequence as follows: 802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS | ||||||
| Isoform 14 (identifier: Q9R1V6-16) Also known as: ADAM22-G21; 22g(D26)[27S]; The sequence of this isoform differs from the canonical sequence as follows: 760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF | ||||||
| Isoform 15 (identifier: Q9R1V6-17) Also known as: ADAM22-G22; 22g(D27)+29.7; The sequence of this isoform differs from the canonical sequence as follows: 766-801: Missing. 857-857: E → DSQDGPHQQDR | ||||||
| Isoform 16 (identifier: Q9R1V6-18) Also known as: ADAM22-G23; 22g(D25D26D27); The sequence of this isoform differs from the canonical sequence as follows: 730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF | ||||||
| Isoform 17 (identifier: Q9R1V6-2) Also known as: ADAM22-A05; Beta; The sequence of this isoform differs from the canonical sequence as follows: 766-801: Missing. 858-904: Missing. | ||||||
| Isoform 18 (identifier: Q9R1V6-19) Also known as: ADAM22-A13; The sequence of this isoform differs from the canonical sequence as follows: 760-801: Missing. 858-904: Missing. | ||||||
| Isoform 19 (identifier: Q9R1V6-20) Also known as: ADAM22-A15; The sequence of this isoform differs from the canonical sequence as follows: 760-765: Missing. 858-904: Missing. | ||||||
| Isoform 20 (identifier: Q9R1V6-1) Also known as: ADAM22-A04; Alpha; The sequence of this isoform differs from the canonical sequence as follows: 858-904: Missing. | ||||||
| Isoform 21 (identifier: Q9R1V6-21) Also known as: ADAM22-A16; The sequence of this isoform differs from the canonical sequence as follows: 766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL 847-904: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||||
| Propeptide | 24 – 223 | 200 | By similarity | PRO_0000029114 | |||||||
| Chain | 224 – 904 | 681 | Disintegrin and metalloproteinase domain-containing protein 22 | PRO_0000029115 | |||||||
Regions | |||||||||||
| Topological domain | 24 – 734 | 711 | Extracellular Potential | ||||||||
| Transmembrane | 735 – 755 | 21 | Helical; Potential | ||||||||
| Topological domain | 756 – 857 | 102 | Cytoplasmic Potential | ||||||||
| Domain | 237 – 436 | 200 | Peptidase M12B | ||||||||
| Domain | 442 – 529 | 88 | Disintegrin | ||||||||
| Domain | 673 – 710 | 38 | EGF-like | ||||||||
| Compositional bias | 533 – 666 | 134 | Cys-rich | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 832 | 1 | Phosphoserine Ref.5 | ||||||||
| Modified residue | 864 | 1 | Phosphoserine Ref.5 | ||||||||
| Modified residue | 866 | 1 | Phosphoserine Ref.5 | ||||||||
| Modified residue | 867 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 868 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 163 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 517 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 632 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 673 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 347 ↔ 431 | By similarity | |||||||||
| Disulfide bond | 390 ↔ 415 | By similarity | |||||||||
| Disulfide bond | 392 ↔ 399 | By similarity | |||||||||
| Disulfide bond | 445 ↔ 475 | By similarity | |||||||||
| Disulfide bond | 456 ↔ 472 | By similarity | |||||||||
| Disulfide bond | 458 ↔ 464 | By similarity | |||||||||
| Disulfide bond | 471 ↔ 492 | By similarity | |||||||||
| Disulfide bond | 483 ↔ 489 | By similarity | |||||||||
| Disulfide bond | 488 ↔ 514 | By similarity | |||||||||
| Disulfide bond | 501 ↔ 521 | By similarity | |||||||||
| Disulfide bond | 508 ↔ 540 | By similarity | |||||||||
| Disulfide bond | 533 ↔ 545 | By similarity | |||||||||
| Disulfide bond | 552 ↔ 603 | By similarity | |||||||||
| Disulfide bond | 567 ↔ 633 | By similarity | |||||||||
| Disulfide bond | 581 ↔ 591 | By similarity | |||||||||
| Disulfide bond | 598 ↔ 661 | By similarity | |||||||||
| Disulfide bond | 655 ↔ 666 | By similarity | |||||||||
| Disulfide bond | 677 ↔ 692 | By similarity | |||||||||
| Disulfide bond | 686 ↔ 698 | By similarity | |||||||||
| Disulfide bond | 700 ↔ 709 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 730 – 904 | 175 | VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16. | VSP_018233 | |||||||
| Alternative sequence | 760 – 904 | 145 | NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14. | VSP_018234 | |||||||
| Alternative sequence | 760 – 801 | 42 | Missing in isoform 3, isoform 4 and isoform 18. | VSP_018235 | |||||||
| Alternative sequence | 760 – 765 | 6 | Missing in isoform 11 and isoform 19. | VSP_018236 | |||||||
| Alternative sequence | 766 – 846 | 81 | QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21. | VSP_018237 | |||||||
| Alternative sequence | 766 – 801 | 36 | Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17. | VSP_018238 | |||||||
| Alternative sequence | 802 | 1 | S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13. | VSP_018239 | |||||||
| Alternative sequence | 847 – 904 | 58 | Missing in isoform 21. | VSP_018240 | |||||||
| Alternative sequence | 857 – 904 | 48 | ETLSP…WETSI → DLGIIT in isoform 7. | VSP_018241 | |||||||
| Alternative sequence | 857 | 1 | E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10. | VSP_018242 | |||||||
| Alternative sequence | 857 | 1 | E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12. | VSP_018243 | |||||||
| Alternative sequence | 857 | 1 | E → DSQDGPHQQDR in isoform 15. | VSP_018244 | |||||||
| Alternative sequence | 857 | 1 | E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6. | VSP_018245 | |||||||
| Alternative sequence | 857 | 1 | E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8. | VSP_018246 | |||||||
| Alternative sequence | 857 | 1 | E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9. | VSP_018247 | |||||||
| Alternative sequence | 858 – 904 | 47 | Missing in isoform 17, isoform 18, isoform 19 and isoform 20. | VSP_018248 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 509 | 1 | D → N: Fails to bind to LGI1. Ref.4 | ||||||||
| Sequence conflict | 639 | 1 | K → R in BAC28742. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23." Sagane K., Yamazaki K., Mizui Y., Tanaka I. Gene 236:79-86(1999) [PubMed: 10433968] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 17 AND 20). Tissue: Brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 619-904 (ISOFORM 2). Strain: C57BL/6J. Tissue: Embryo. |
| [3] | "Ataxia and peripheral nerve hypomyelination in ADAM22-deficient mice." Sagane K., Hayakawa K., Kai J., Hirohashi T., Takahashi E., Miyamoto N., Ino M., Oki T., Yamazaki K., Nagasu T. BMC Neurosci. 6:33-33(2005) [PubMed: 15876356] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-904 (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20 AND 21), TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [4] | "Epilepsy-related ligand/receptor complex LGI1 and ADAM22 regulate synaptic transmission." Fukata Y., Adesnik H., Iwanaga T., Bredt D.S., Nicoll R.A., Fukata M. Science 313:1792-1795(2006) [PubMed: 16990550] [Abstract] Cited for: FUNCTION, INTERACTION WITH LGI1, MUTAGENESIS OF ASP-509. |
| [5] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-832; SER-864 AND SER-866, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [6] | "LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11." Sagane K., Ishihama Y., Sugimoto H. Int. J. Biol. Sci. 4:387-396(2008) [PubMed: 18974846] [Abstract] Cited for: INTERACTION WITH LIGI1 AND LGI4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB009674 mRNA. Translation: BAA83382.1. AB009674 mRNA. Translation: BAA83383.1. AK034528 mRNA. Translation: BAC28742.1. AB179842 mRNA. Translation: BAD72803.1. AB179843 mRNA. Translation: BAD72804.1. AB179844 mRNA. Translation: BAD72805.1. AB179845 mRNA. Translation: BAD72806.1. AB179846 mRNA. Translation: BAD72807.1. AB179847 mRNA. Translation: BAD72808.1. AB179848 mRNA. Translation: BAD72809.1. AB179849 mRNA. Translation: BAD72810.1. AB179850 mRNA. Translation: BAD72811.1. AB179851 mRNA. Translation: BAD72812.1. AB179852 mRNA. Translation: BAD72813.1. AB179853 mRNA. Translation: BAD72814.1. AB179854 mRNA. Translation: BAD72815.1. AB179855 mRNA. Translation: BAD72816.1. AB179856 mRNA. Translation: BAD72817.1. AB179857 mRNA. Translation: BAD72818.1. AB179858 mRNA. Translation: BAD72819.1. AB179859 mRNA. Translation: BAD72820.1. AB179860 mRNA. Translation: BAD72821.1. AB179861 mRNA. Translation: BAD72822.1. AB179862 mRNA. Translation: BAD72823.1. |
| IPI | IPI00378796. IPI00379467. IPI00404650. IPI00515160. IPI00515396. IPI00515509. IPI00515580. IPI00515604. IPI00515681. IPI00623219. IPI00627016. IPI00749834. IPI00752301. IPI00752342. IPI00753070. IPI00753519. IPI00753532. IPI00753983. IPI00754961. IPI00755165. IPI01008448. |
| RefSeq | NP_001007221.1. NM_001007220.2. NP_001007222.1. NM_001007221.2. NP_001091695.1. NM_001098225.1. |
| UniGene | Mm.275895. |
3D structure databases | |
| ProteinModelPortal | Q9R1V6. |
| SMR | Q9R1V6. Positions 231-716. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9R1V6. 4 interactions. |
| STRING | Q9R1V6. |
Protein family/group databases | |
| MEROPS | M12.978. |
PTM databases | |
| PhosphoSite | Q9R1V6. |
Proteomic databases | |
| PRIDE | Q9R1V6. |
Protocols and materials databases | |
| DNASU | 11496. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. ENSMUST00000078296; ENSMUSP00000077412; ENSMUSG00000040537. ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. ENSMUST00000088745; ENSMUSP00000086123; ENSMUSG00000040537. ENSMUST00000088746; ENSMUSP00000086124; ENSMUSG00000040537. ENSMUST00000088752; ENSMUSP00000086130; ENSMUSG00000040537. ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. ENSMUST00000088762; ENSMUSP00000086140; ENSMUSG00000040537. ENSMUST00000102987; ENSMUSP00000100052; ENSMUSG00000040537. ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. |
| GeneID | 11496. |
| KEGG | mmu:11496. |
| UCSC | uc008wjv.1. mouse. uc008wjy.1. mouse. uc008wjz.1. mouse. |
Organism-specific databases | |
| CTD | 53616. |
| MGI | MGI:1340046. Adam22. |
Phylogenomic databases | |
| eggNOG | NOG256419. |
| GeneTree | ENSGT00650000092917. |
| HOVERGEN | HBG050456. |
| OMA | VHLFSGS. |
| OrthoDB | EOG44J2HD. |
Gene expression databases | |
| ArrayExpress | Q9R1V6. |
| Bgee | Q9R1V6. |
| CleanEx | MM_ADAM22. |
| Genevestigator | Q9R1V6. |
| GermOnline | ENSMUSG00000040537. Mus musculus. |
Family and domain databases | |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. G3DSA:3.40.390.10. G3DSA:3.40.390.10. 1 hit. |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR018358. Disintegrin_CS. IPR000742. EG-like_dom. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR024079. MetalloPept_cat_dom. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| PRINTS | PR00289. DISINTEGRIN. |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. SM00181. EGF. 1 hit. [Graphical view] |
| SUPFAM | SSF57552. Disintegrin. 1 hit. |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00427. DISINTEGRIN_1. 1 hit. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. 1 hit. PS01186. EGF_2. False negative. PS50026. EGF_3. 1 hit. PS00142. ZINC_PROTEASE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 278878. |
| SOURCE | Search... |
Entry information
| Entry name | ADA22_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9R1V6 Secondary accession number(s): Q5TLI8 Q9R1V5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with