Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

Adam22

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation (By similarity). Neuronal receptor for LGI1.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

  • adult locomotory behavior Source: MGI
  • gliogenesis Source: MGI
  • myelination in peripheral nervous system Source: MGI
  • Schwann cell differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

ReactomeiR-MMU-5682910. LGI-ADAM interactions.

Protein family/group databases

MEROPSiM12.978.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
Gene namesi
Name:Adam22
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1340046. Adam22.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini24 – 734ExtracellularSequence analysisAdd BLAST711
Transmembranei735 – 755HelicalSequence analysisAdd BLAST21
Topological domaini756 – 857CytoplasmicSequence analysisAdd BLAST102

GO - Cellular componenti

  • axon Source: UniProtKB
  • integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Membrane

Pathology & Biotechi

Disruption phenotypei

Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi509D → N: Fails to bind to LGI1. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
PropeptideiPRO_000002911424 – 223By similarityAdd BLAST200
ChainiPRO_0000029115224 – 904Disintegrin and metalloproteinase domain-containing protein 22Add BLAST681

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi163N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi347 ↔ 431By similarity
Disulfide bondi390 ↔ 415By similarity
Disulfide bondi392 ↔ 399By similarity
Disulfide bondi445 ↔ 475By similarity
Disulfide bondi456 ↔ 472By similarity
Disulfide bondi458 ↔ 464By similarity
Disulfide bondi471 ↔ 492By similarity
Disulfide bondi483 ↔ 489By similarity
Disulfide bondi488 ↔ 514By similarity
Disulfide bondi501 ↔ 521By similarity
Disulfide bondi508 ↔ 540By similarity
Glycosylationi517N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi533 ↔ 545By similarity
Disulfide bondi552 ↔ 603By similarity
Disulfide bondi567 ↔ 633By similarity
Disulfide bondi581 ↔ 591By similarity
Disulfide bondi598 ↔ 661By similarity
Glycosylationi632N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi655 ↔ 666By similarity
Glycosylationi673N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi677 ↔ 692By similarity
Disulfide bondi686 ↔ 698By similarity
Disulfide bondi700 ↔ 709By similarity
Modified residuei808PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei855PhosphoserineCombined sources1
Modified residuei860PhosphoserineCombined sources1
Modified residuei864PhosphoserineCombined sources1
Modified residuei868PhosphoserineCombined sources1
Isoform 8 (identifier: Q9R1V6-10)
Modified residuei817PhosphoserineCombined sources1
Isoform 12 (identifier: Q9R1V6-14)
Modified residuei882PhosphoserineCombined sources1

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9R1V6.
PaxDbiQ9R1V6.
PeptideAtlasiQ9R1V6.
PRIDEiQ9R1V6.

PTM databases

iPTMnetiQ9R1V6.
PhosphoSitePlusiQ9R1V6.

Expressioni

Tissue specificityi

Detected in juxtaparanodal zones in the central nervous system and at nerve terminal plexuses of basket cells in the cerebellum (at protein level) (PubMed:20089912). Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter.2 Publications

Gene expression databases

BgeeiENSMUSG00000040537.
CleanExiMM_ADAM22.
ExpressionAtlasiQ9R1V6. baseline and differential.
GenevisibleiQ9R1V6. MM.

Interactioni

Subunit structurei

Interacts with LGI1 (PubMed:18974846, PubMed:20089912). Can bind to LGI4(PubMed:18974846). Interacts with KCNA2, DLG2 and DLG4 (PubMed:20089912).3 Publications

Protein-protein interaction databases

IntActiQ9R1V6. 5 interactors.
MINTiMINT-4086922.
STRINGi10090.ENSMUSP00000055000.

Structurei

3D structure databases

ProteinModelPortaliQ9R1V6.
SMRiQ9R1V6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini237 – 436Peptidase M12BPROSITE-ProRule annotationAdd BLAST200
Domaini442 – 529DisintegrinPROSITE-ProRule annotationAdd BLAST88
Domaini673 – 710EGF-likePROSITE-ProRule annotationAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi533 – 666Cys-richAdd BLAST134

Sequence similaritiesi

Contains 1 disintegrin domain.PROSITE-ProRule annotation
Contains 1 EGF-like domain.PROSITE-ProRule annotation
Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3607. Eukaryota.
ENOG410XX2M. LUCA.
GeneTreeiENSGT00800000124044.
HOVERGENiHBG050456.
InParanoidiQ9R1V6.
KOiK16068.
OMAiKYIWGQK.
OrthoDBiEOG091G010C.
PhylomeDBiQ9R1V6.
TreeFamiTF314733.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR018358. Disintegrin_CS.
IPR001762. Disintegrin_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR013111. EGF_extracell.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF07974. EGF_2. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSiPR00289. DISINTEGRIN.
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]

Sequences (21)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 21 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9R1V6-3) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G01, 22g

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP
60 70 80 90 100
LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL
110 120 130 140 150
DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS
160 170 180 190 200
TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS
210 220 230 240 250
EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF
260 270 280 290 300
KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS
310 320 330 340 350
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL
360 370 380 390 400
RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI
410 420 430 440 450
MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI
460 470 480 490 500
ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV
510 520 530 540 550
CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR
560 570 580 590 600
QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY
610 620 630 640 650
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE
660 670 680 690 700
DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC
710 720 730 740 750
NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI
760 770 780 790 800
LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK
810 820 830 840 850
RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR
860 870 880 890 900
PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW

ETSI
Length:904
Mass (Da):99,715
Last modified:May 2, 2006 - v2
Checksum:i0FBBD09398EE0B97
GO
Isoform 2 (identifier: Q9R1V6-4) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G03, 22g(D27)

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.

Show »
Length:868
Mass (Da):95,927
Checksum:iC0FA966057D2C5C8
GO
Isoform 3 (identifier: Q9R1V6-5) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G06, 22g(D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.

Show »
Length:862
Mass (Da):95,080
Checksum:i17E4012489871450
GO
Isoform 4 (identifier: Q9R1V6-6) [UniParc]FASTAAdd to basket
Also known as: ADAM22=G07, 22g(D26D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:899
Mass (Da):98,855
Checksum:iDAFB8A148524416E
GO
Isoform 5 (identifier: Q9R1V6-7) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G08, 22g(D27)+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:905
Mass (Da):99,702
Checksum:i6AAA73D541AFB536
GO
Isoform 6 (identifier: Q9R1V6-8) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G09, 22g+29.3

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

Show »
Length:941
Mass (Da):103,490
Checksum:iD23B93F0032CBBCF
GO
Isoform 7 (identifier: Q9R1V6-9) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G10, 22g+29.1

The sequence of this isoform differs from the canonical sequence as follows:
     857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT

Show »
Length:862
Mass (Da):95,224
Checksum:i30A066885BBA38FB
GO
Isoform 8 (identifier: Q9R1V6-10) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G11, 22g(D27)+29.5+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR

Show »
Length:907
Mass (Da):100,669
Checksum:iE228AF65D914F778
GO
Isoform 9 (identifier: Q9R1V6-11) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G12, 22g+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:970
Mass (Da):107,122
Checksum:iABBCD4AD024F349B
GO
Isoform 10 (identifier: Q9R1V6-12) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G17, 22G[27L]+29.3+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR

Show »
Length:980
Mass (Da):107,831
Checksum:i45BE20975A1D5820
GO
Isoform 11 (identifier: Q9R1V6-13) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G18, 22g(D26)[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:927
Mass (Da):102,129
Checksum:iBD4C6B317C47EFAB
GO
Isoform 12 (identifier: Q9R1V6-14) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G19, 22g[27L]+29.5

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Show »
Length:962
Mass (Da):106,608
Checksum:iD77057A06FD2A7E4
GO
Isoform 13 (identifier: Q9R1V6-15) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G20, 22g[27L]

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

Show »
Length:933
Mass (Da):102,976
Checksum:i1052AC188694EDFC
GO
Isoform 14 (identifier: Q9R1V6-16) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G21, 22g(D26)[27S]

The sequence of this isoform differs from the canonical sequence as follows:
     760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF

Show »
Length:883
Mass (Da):97,640
Checksum:iC3A2C695E08B72F9
GO
Isoform 15 (identifier: Q9R1V6-17) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G22, 22g(D27)+29.7

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → DSQDGPHQQDR

Show »
Length:878
Mass (Da):97,062
Checksum:i251D63D6D6CAF0A3
GO
Isoform 16 (identifier: Q9R1V6-18) [UniParc]FASTAAdd to basket
Also known as: ADAM22-G23, 22g(D25D26D27)

The sequence of this isoform differs from the canonical sequence as follows:
     730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF

Show »
Length:832
Mass (Da):92,271
Checksum:i6BB6F0B5CA150F28
GO
Isoform 17 (identifier: Q9R1V6-2) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A05, Beta

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     858-904: Missing.

Show »
Length:821
Mass (Da):90,952
Checksum:i4F8F12B425EB683C
GO
Isoform 18 (identifier: Q9R1V6-19) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A13

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     858-904: Missing.

Show »
Length:815
Mass (Da):90,105
Checksum:i59F2A397E25E283F
GO
Isoform 19 (identifier: Q9R1V6-20) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A15

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     858-904: Missing.

Show »
Length:851
Mass (Da):93,893
Checksum:iB1A6A8713614459E
GO
Isoform 20 (identifier: Q9R1V6-1) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A04, Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     858-904: Missing.

Show »
Length:857
Mass (Da):94,740
Checksum:iCB88FB7000208E09
GO
Isoform 21 (identifier: Q9R1V6-21) [UniParc]FASTAAdd to basket
Also known as: ADAM22-A16

The sequence of this isoform differs from the canonical sequence as follows:
     766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
     847-904: Missing.

Show »
Length:846
Mass (Da):93,592
Checksum:i08A647F010B67028
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti639K → R in BAC28742 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018233730 – 904VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16. 1 PublicationAdd BLAST175
Alternative sequenceiVSP_018234760 – 904NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14. 1 PublicationAdd BLAST145
Alternative sequenceiVSP_018235760 – 801Missing in isoform 3, isoform 4 and isoform 18. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_018236760 – 765Missing in isoform 11 and isoform 19. 1 Publication6
Alternative sequenceiVSP_018237766 – 846QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_018238766 – 801Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_018239802S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13. 1 Publication1
Alternative sequenceiVSP_018240847 – 904Missing in isoform 21. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_018241857 – 904ETLSP…WETSI → DLGIIT in isoform 7. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_018242857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10. 1 Publication1
Alternative sequenceiVSP_018243857E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12. 1 Publication1
Alternative sequenceiVSP_018244857E → DSQDGPHQQDR in isoform 15. 1 Publication1
Alternative sequenceiVSP_018245857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6. 1 Publication1
Alternative sequenceiVSP_018246857E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8. 1 Publication1
Alternative sequenceiVSP_018247857E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9. 1 Publication1
Alternative sequenceiVSP_018248858 – 904Missing in isoform 17, isoform 18, isoform 19 and isoform 20. 2 PublicationsAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009674 mRNA. Translation: BAA83382.1.
AB009674 mRNA. Translation: BAA83383.1.
AK034528 mRNA. Translation: BAC28742.1.
AB179842 mRNA. Translation: BAD72803.1.
AB179843 mRNA. Translation: BAD72804.1.
AB179844 mRNA. Translation: BAD72805.1.
AB179845 mRNA. Translation: BAD72806.1.
AB179846 mRNA. Translation: BAD72807.1.
AB179847 mRNA. Translation: BAD72808.1.
AB179848 mRNA. Translation: BAD72809.1.
AB179849 mRNA. Translation: BAD72810.1.
AB179850 mRNA. Translation: BAD72811.1.
AB179851 mRNA. Translation: BAD72812.1.
AB179852 mRNA. Translation: BAD72813.1.
AB179853 mRNA. Translation: BAD72814.1.
AB179854 mRNA. Translation: BAD72815.1.
AB179855 mRNA. Translation: BAD72816.1.
AB179856 mRNA. Translation: BAD72817.1.
AB179857 mRNA. Translation: BAD72818.1.
AB179858 mRNA. Translation: BAD72819.1.
AB179859 mRNA. Translation: BAD72820.1.
AB179860 mRNA. Translation: BAD72821.1.
AB179861 mRNA. Translation: BAD72822.1.
AB179862 mRNA. Translation: BAD72823.1.
CCDSiCCDS19080.1. [Q9R1V6-1]
CCDS51411.1. [Q9R1V6-4]
CCDS80205.1. [Q9R1V6-6]
CCDS80207.1. [Q9R1V6-3]
RefSeqiNP_001007221.1. NM_001007220.3. [Q9R1V6-1]
NP_001007222.1. NM_001007221.3. [Q9R1V6-2]
NP_001091695.1. NM_001098225.2. [Q9R1V6-4]
NP_001297368.1. NM_001310439.1. [Q9R1V6-6]
NP_001297369.1. NM_001310440.1. [Q9R1V6-3]
XP_006503592.1. XM_006503529.3. [Q9R1V6-12]
XP_006503593.1. XM_006503530.3. [Q9R1V6-11]
XP_006503594.1. XM_006503531.3. [Q9R1V6-14]
XP_006503596.1. XM_006503533.3. [Q9R1V6-8]
XP_006503598.1. XM_006503535.3. [Q9R1V6-15]
XP_006503600.1. XM_006503537.3. [Q9R1V6-7]
XP_006503605.1. XM_006503542.3. [Q9R1V6-5]
UniGeneiMm.275895.

Genome annotation databases

EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. [Q9R1V6-6]
GeneIDi11496.
KEGGimmu:11496.
UCSCiuc008wjk.2. mouse. [Q9R1V6-3]
uc008wjv.1. mouse. [Q9R1V6-4]
uc008wjy.1. mouse. [Q9R1V6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009674 mRNA. Translation: BAA83382.1.
AB009674 mRNA. Translation: BAA83383.1.
AK034528 mRNA. Translation: BAC28742.1.
AB179842 mRNA. Translation: BAD72803.1.
AB179843 mRNA. Translation: BAD72804.1.
AB179844 mRNA. Translation: BAD72805.1.
AB179845 mRNA. Translation: BAD72806.1.
AB179846 mRNA. Translation: BAD72807.1.
AB179847 mRNA. Translation: BAD72808.1.
AB179848 mRNA. Translation: BAD72809.1.
AB179849 mRNA. Translation: BAD72810.1.
AB179850 mRNA. Translation: BAD72811.1.
AB179851 mRNA. Translation: BAD72812.1.
AB179852 mRNA. Translation: BAD72813.1.
AB179853 mRNA. Translation: BAD72814.1.
AB179854 mRNA. Translation: BAD72815.1.
AB179855 mRNA. Translation: BAD72816.1.
AB179856 mRNA. Translation: BAD72817.1.
AB179857 mRNA. Translation: BAD72818.1.
AB179858 mRNA. Translation: BAD72819.1.
AB179859 mRNA. Translation: BAD72820.1.
AB179860 mRNA. Translation: BAD72821.1.
AB179861 mRNA. Translation: BAD72822.1.
AB179862 mRNA. Translation: BAD72823.1.
CCDSiCCDS19080.1. [Q9R1V6-1]
CCDS51411.1. [Q9R1V6-4]
CCDS80205.1. [Q9R1V6-6]
CCDS80207.1. [Q9R1V6-3]
RefSeqiNP_001007221.1. NM_001007220.3. [Q9R1V6-1]
NP_001007222.1. NM_001007221.3. [Q9R1V6-2]
NP_001091695.1. NM_001098225.2. [Q9R1V6-4]
NP_001297368.1. NM_001310439.1. [Q9R1V6-6]
NP_001297369.1. NM_001310440.1. [Q9R1V6-3]
XP_006503592.1. XM_006503529.3. [Q9R1V6-12]
XP_006503593.1. XM_006503530.3. [Q9R1V6-11]
XP_006503594.1. XM_006503531.3. [Q9R1V6-14]
XP_006503596.1. XM_006503533.3. [Q9R1V6-8]
XP_006503598.1. XM_006503535.3. [Q9R1V6-15]
XP_006503600.1. XM_006503537.3. [Q9R1V6-7]
XP_006503605.1. XM_006503542.3. [Q9R1V6-5]
UniGeneiMm.275895.

3D structure databases

ProteinModelPortaliQ9R1V6.
SMRiQ9R1V6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9R1V6. 5 interactors.
MINTiMINT-4086922.
STRINGi10090.ENSMUSP00000055000.

Protein family/group databases

MEROPSiM12.978.

PTM databases

iPTMnetiQ9R1V6.
PhosphoSitePlusiQ9R1V6.

Proteomic databases

MaxQBiQ9R1V6.
PaxDbiQ9R1V6.
PeptideAtlasiQ9R1V6.
PRIDEiQ9R1V6.

Protocols and materials databases

DNASUi11496.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. [Q9R1V6-6]
GeneIDi11496.
KEGGimmu:11496.
UCSCiuc008wjk.2. mouse. [Q9R1V6-3]
uc008wjv.1. mouse. [Q9R1V6-4]
uc008wjy.1. mouse. [Q9R1V6-2]

Organism-specific databases

CTDi53616.
MGIiMGI:1340046. Adam22.

Phylogenomic databases

eggNOGiKOG3607. Eukaryota.
ENOG410XX2M. LUCA.
GeneTreeiENSGT00800000124044.
HOVERGENiHBG050456.
InParanoidiQ9R1V6.
KOiK16068.
OMAiKYIWGQK.
OrthoDBiEOG091G010C.
PhylomeDBiQ9R1V6.
TreeFamiTF314733.

Enzyme and pathway databases

ReactomeiR-MMU-5682910. LGI-ADAM interactions.

Miscellaneous databases

ChiTaRSiAdam22. mouse.
PROiQ9R1V6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000040537.
CleanExiMM_ADAM22.
ExpressionAtlasiQ9R1V6. baseline and differential.
GenevisibleiQ9R1V6. MM.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR018358. Disintegrin_CS.
IPR001762. Disintegrin_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR013111. EGF_extracell.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF07974. EGF_2. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSiPR00289. DISINTEGRIN.
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiADA22_MOUSE
AccessioniPrimary (citable) accession number: Q9R1V6
Secondary accession number(s): Q5TLI8
, Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 2, 2006
Last modified: November 2, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.