Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9R1V6 (ADA22_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Disintegrin and metalloproteinase domain-containing protein 22

Short name=ADAM 22
Gene names
Name:Adam22
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length904 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation By similarity. Neuronal receptor for LGI1. Ref.4

Subunit structure

Interacts with LGI1. Can bind to LGI4. Ref.4 Ref.5

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter. Ref.3

Post-translational modification

The precursor is cleaved by a furin endopeptidase By similarity.

Disruption phenotype

Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves. Ref.3

Sequence similarities

Contains 1 disintegrin domain.

Contains 1 EGF-like domain.

Contains 1 peptidase M12B domain.

Alternative products

This entry describes 21 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9R1V6-3)

Also known as: ADAM22-G01; 22g;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9R1V6-4)

Also known as: ADAM22-G03; 22g(D27);

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
Isoform 3 (identifier: Q9R1V6-5)

Also known as: ADAM22-G06; 22g(D26D27);

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
Isoform 4 (identifier: Q9R1V6-6)

Also known as: ADAM22=G07; 22g(D26D27)+29.3;

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR
Isoform 5 (identifier: Q9R1V6-7)

Also known as: ADAM22-G08; 22g(D27)+29.3;

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR
Isoform 6 (identifier: Q9R1V6-8)

Also known as: ADAM22-G09; 22g+29.3;

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR
Isoform 7 (identifier: Q9R1V6-9)

Also known as: ADAM22-G10; 22g+29.1;

The sequence of this isoform differs from the canonical sequence as follows:
     857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT
Isoform 8 (identifier: Q9R1V6-10)

Also known as: ADAM22-G11; 22g(D27)+29.5+29.7;

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR
Isoform 9 (identifier: Q9R1V6-11)

Also known as: ADAM22-G12; 22g+29.3+29.7;

The sequence of this isoform differs from the canonical sequence as follows:
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR
Isoform 10 (identifier: Q9R1V6-12)

Also known as: ADAM22-G17; 22G[27L]+29.3+29.7;

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR
Isoform 11 (identifier: Q9R1V6-13)

Also known as: ADAM22-G18; 22g(D26)[27L];

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
Isoform 12 (identifier: Q9R1V6-14)

Also known as: ADAM22-G19; 22g[27L]+29.5;

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
     857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR
Isoform 13 (identifier: Q9R1V6-15)

Also known as: ADAM22-G20; 22g[27L];

The sequence of this isoform differs from the canonical sequence as follows:
     802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
Isoform 14 (identifier: Q9R1V6-16)

Also known as: ADAM22-G21; 22g(D26)[27S];

The sequence of this isoform differs from the canonical sequence as follows:
     760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF
Isoform 15 (identifier: Q9R1V6-17)

Also known as: ADAM22-G22; 22g(D27)+29.7;

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     857-857: E → DSQDGPHQQDR
Isoform 16 (identifier: Q9R1V6-18)

Also known as: ADAM22-G23; 22g(D25D26D27);

The sequence of this isoform differs from the canonical sequence as follows:
     730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF
Isoform 17 (identifier: Q9R1V6-2)

Also known as: ADAM22-A05; Beta;

The sequence of this isoform differs from the canonical sequence as follows:
     766-801: Missing.
     858-904: Missing.
Isoform 18 (identifier: Q9R1V6-19)

Also known as: ADAM22-A13;

The sequence of this isoform differs from the canonical sequence as follows:
     760-801: Missing.
     858-904: Missing.
Isoform 19 (identifier: Q9R1V6-20)

Also known as: ADAM22-A15;

The sequence of this isoform differs from the canonical sequence as follows:
     760-765: Missing.
     858-904: Missing.
Isoform 20 (identifier: Q9R1V6-1)

Also known as: ADAM22-A04; Alpha;

The sequence of this isoform differs from the canonical sequence as follows:
     858-904: Missing.
Isoform 21 (identifier: Q9R1V6-21)

Also known as: ADAM22-A16;

The sequence of this isoform differs from the canonical sequence as follows:
     766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
     847-904: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2323 Potential
Propeptide24 – 223200 By similarity
PRO_0000029114
Chain224 – 904681Disintegrin and metalloproteinase domain-containing protein 22
PRO_0000029115

Regions

Topological domain24 – 734711Extracellular Potential
Transmembrane735 – 75521Helical; Potential
Topological domain756 – 857102Cytoplasmic Potential
Domain237 – 436200Peptidase M12B
Domain442 – 52988Disintegrin
Domain673 – 71038EGF-like
Compositional bias533 – 666134Cys-rich

Amino acid modifications

Modified residue8321Phosphoserine By similarity
Glycosylation1631N-linked (GlcNAc...) Potential
Glycosylation5171N-linked (GlcNAc...) Potential
Glycosylation6321N-linked (GlcNAc...) Potential
Glycosylation6731N-linked (GlcNAc...) Potential
Disulfide bond347 ↔ 431 By similarity
Disulfide bond390 ↔ 415 By similarity
Disulfide bond392 ↔ 399 By similarity
Disulfide bond445 ↔ 475 By similarity
Disulfide bond456 ↔ 472 By similarity
Disulfide bond458 ↔ 464 By similarity
Disulfide bond471 ↔ 492 By similarity
Disulfide bond483 ↔ 489 By similarity
Disulfide bond488 ↔ 514 By similarity
Disulfide bond501 ↔ 521 By similarity
Disulfide bond508 ↔ 540 By similarity
Disulfide bond533 ↔ 545 By similarity
Disulfide bond552 ↔ 603 By similarity
Disulfide bond567 ↔ 633 By similarity
Disulfide bond581 ↔ 591 By similarity
Disulfide bond598 ↔ 661 By similarity
Disulfide bond655 ↔ 666 By similarity
Disulfide bond677 ↔ 692 By similarity
Disulfide bond686 ↔ 698 By similarity
Disulfide bond700 ↔ 709 By similarity

Natural variations

Alternative sequence730 – 904175VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16.
VSP_018233
Alternative sequence760 – 904145NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14.
VSP_018234
Alternative sequence760 – 80142Missing in isoform 3, isoform 4 and isoform 18.
VSP_018235
Alternative sequence760 – 7656Missing in isoform 11 and isoform 19.
VSP_018236
Alternative sequence766 – 84681QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21.
VSP_018237
Alternative sequence766 – 80136Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17.
VSP_018238
Alternative sequence8021S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13.
VSP_018239
Alternative sequence847 – 90458Missing in isoform 21.
VSP_018240
Alternative sequence857 – 90448ETLSP…WETSI → DLGIIT in isoform 7.
VSP_018241
Alternative sequence8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10.
VSP_018242
Alternative sequence8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12.
VSP_018243
Alternative sequence8571E → DSQDGPHQQDR in isoform 15.
VSP_018244
Alternative sequence8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6.
VSP_018245
Alternative sequence8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8.
VSP_018246
Alternative sequence8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9.
VSP_018247
Alternative sequence858 – 90447Missing in isoform 17, isoform 18, isoform 19 and isoform 20.
VSP_018248

Experimental info

Mutagenesis5091D → N: Fails to bind to LGI1. Ref.4
Sequence conflict6391K → R in BAC28742. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (ADAM22-G01) (22g) [UniParc].

Last modified May 2, 2006. Version 2.
Checksum: 0FBBD09398EE0B97

FASTA90499,715
        10         20         30         40         50         60 
MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP LRLIYRLGGE 

        70         80         90        100        110        120 
DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL DVLLNHELLS SGYVERQIEH 

       130        140        150        160        170        180 
GGKVVENKGG EHCYYQGQIR GNPVSFVALS TCHGLHGMFY DGNHTYLIEP EENEKSQESS 

       190        200        210        220        230        240 
HCHSVYKSRQ FEFPLDDLPS EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE 

       250        260        270        280        290        300 
LMIVNDHLMF KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS 

       310        320        330        340        350        360 
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL RGGGVNEFGK 

       370        380        390        400        410        420 
TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI MGDTGYYLPK KFTQCNVEEY 

       430        440        450        460        470        480 
HDFLNSGGGA CLFNKPSKLL DPPECGNGFI ETGEECDCGT PAECALEGAE CCKKCTLTQD 

       490        500        510        520        530        540 
SQCSDGLCCK KCKFQPLGTV CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC 

       550        560        570        580        590        600 
FGGRCKTRDR QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY 

       610        620        630        640        650        660 
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE DGTPCGPQMM 

       670        680        690        700        710        720 
CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC NRHWTGADCG THFPHNDDAK 

       730        740        750        760        770        780 
TGITLSGNGV AGTNIIIGII AGTILVLALI LGITAWGYKN YREQRQLPQG DYVKKPGDGD 

       790        800        810        820        830        840 
SFYSDFPPGG STNSASSSKK RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN 

       850        860        870        880        890        900 
KKKIRGKRFR PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW 


ETSI 

« Hide

Isoform 2 (ADAM22-G03) (22g(D27)) [UniParc].

Checksum: C0FA966057D2C5C8
Show »

FASTA86895,927
Isoform 3 (ADAM22-G06) (22g(D26D27)) [UniParc].

Checksum: 17E4012489871450
Show »

FASTA86295,080
Isoform 4 (ADAM22=G07) (22g(D26D27)+29.3) [UniParc].

Checksum: DAFB8A148524416E
Show »

FASTA89998,855
Isoform 5 (ADAM22-G08) (22g(D27)+29.3) [UniParc].

Checksum: 6AAA73D541AFB536
Show »

FASTA90599,702
Isoform 6 (ADAM22-G09) (22g+29.3) [UniParc].

Checksum: D23B93F0032CBBCF
Show »

FASTA941103,490
Isoform 7 (ADAM22-G10) (22g+29.1) [UniParc].

Checksum: 30A066885BBA38FB
Show »

FASTA86295,224
Isoform 8 (ADAM22-G11) (22g(D27)+29.5+29.7) [UniParc].

Checksum: E228AF65D914F778
Show »

FASTA907100,669
Isoform 9 (ADAM22-G12) (22g+29.3+29.7) [UniParc].

Checksum: ABBCD4AD024F349B
Show »

FASTA970107,122
Isoform 10 (ADAM22-G17) (22G[27L]+29.3+29.7) [UniParc].

Checksum: 45BE20975A1D5820
Show »

FASTA980107,831
Isoform 11 (ADAM22-G18) (22g(D26)[27L]) [UniParc].

Checksum: BD4C6B317C47EFAB
Show »

FASTA927102,129
Isoform 12 (ADAM22-G19) (22g[27L]+29.5) [UniParc].

Checksum: D77057A06FD2A7E4
Show »

FASTA962106,608
Isoform 13 (ADAM22-G20) (22g[27L]) [UniParc].

Checksum: 1052AC188694EDFC
Show »

FASTA933102,976
Isoform 14 (ADAM22-G21) (22g(D26)[27S]) [UniParc].

Checksum: C3A2C695E08B72F9
Show »

FASTA88397,640
Isoform 15 (ADAM22-G22) (22g(D27)+29.7) [UniParc].

Checksum: 251D63D6D6CAF0A3
Show »

FASTA87897,062
Isoform 16 (ADAM22-G23) (22g(D25D26D27)) [UniParc].

Checksum: 6BB6F0B5CA150F28
Show »

FASTA83292,271
Isoform 17 (ADAM22-A05) (Beta) [UniParc].

Checksum: 4F8F12B425EB683C
Show »

FASTA82190,952
Isoform 18 (ADAM22-A13) [UniParc].

Checksum: 59F2A397E25E283F
Show »

FASTA81590,105
Isoform 19 (ADAM22-A15) [UniParc].

Checksum: B1A6A8713614459E
Show »

FASTA85193,893
Isoform 20 (ADAM22-A04) (Alpha) [UniParc].

Checksum: CB88FB7000208E09
Show »

FASTA85794,740
Isoform 21 (ADAM22-A16) [UniParc].

Checksum: 08A647F010B67028
Show »

FASTA84693,592

References

« Hide 'large scale' references
[1]"Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
Sagane K., Yamazaki K., Mizui Y., Tanaka I.
Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 17 AND 20).
Tissue: Brain.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 619-904 (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Embryo.
[3]"Ataxia and peripheral nerve hypomyelination in ADAM22-deficient mice."
Sagane K., Hayakawa K., Kai J., Hirohashi T., Takahashi E., Miyamoto N., Ino M., Oki T., Yamazaki K., Nagasu T.
BMC Neurosci. 6:33-33(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-904 (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20 AND 21), TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
[4]"Epilepsy-related ligand/receptor complex LGI1 and ADAM22 regulate synaptic transmission."
Fukata Y., Adesnik H., Iwanaga T., Bredt D.S., Nicoll R.A., Fukata M.
Science 313:1792-1795(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH LGI1, MUTAGENESIS OF ASP-509.
[5]"LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
Sagane K., Ishihama Y., Sugimoto H.
Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH LIGI1 AND LGI4.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB009674 mRNA. Translation: BAA83382.1.
AB009674 mRNA. Translation: BAA83383.1.
AK034528 mRNA. Translation: BAC28742.1.
AB179842 mRNA. Translation: BAD72803.1.
AB179843 mRNA. Translation: BAD72804.1.
AB179844 mRNA. Translation: BAD72805.1.
AB179845 mRNA. Translation: BAD72806.1.
AB179846 mRNA. Translation: BAD72807.1.
AB179847 mRNA. Translation: BAD72808.1.
AB179848 mRNA. Translation: BAD72809.1.
AB179849 mRNA. Translation: BAD72810.1.
AB179850 mRNA. Translation: BAD72811.1.
AB179851 mRNA. Translation: BAD72812.1.
AB179852 mRNA. Translation: BAD72813.1.
AB179853 mRNA. Translation: BAD72814.1.
AB179854 mRNA. Translation: BAD72815.1.
AB179855 mRNA. Translation: BAD72816.1.
AB179856 mRNA. Translation: BAD72817.1.
AB179857 mRNA. Translation: BAD72818.1.
AB179858 mRNA. Translation: BAD72819.1.
AB179859 mRNA. Translation: BAD72820.1.
AB179860 mRNA. Translation: BAD72821.1.
AB179861 mRNA. Translation: BAD72822.1.
AB179862 mRNA. Translation: BAD72823.1.
RefSeqNP_001007221.1. NM_001007220.2.
NP_001007222.1. NM_001007221.2.
NP_001091695.1. NM_001098225.1.
XP_006503592.1. XM_006503529.1.
XP_006503593.1. XM_006503530.1.
XP_006503594.1. XM_006503531.1.
XP_006503596.1. XM_006503533.1.
XP_006503598.1. XM_006503535.1.
XP_006503600.1. XM_006503537.1.
XP_006503601.1. XM_006503538.1.
XP_006503602.1. XM_006503539.1.
XP_006503605.1. XM_006503542.1.
UniGeneMm.275895.

3D structure databases

ProteinModelPortalQ9R1V6.
SMRQ9R1V6. Positions 231-716.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ9R1V6. 5 interactions.
MINTMINT-4086922.

Protein family/group databases

MEROPSM12.978.

PTM databases

PhosphoSiteQ9R1V6.

Proteomic databases

PaxDbQ9R1V6.
PRIDEQ9R1V6.

Protocols and materials databases

DNASU11496.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. [Q9R1V6-1]
ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. [Q9R1V6-4]
ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. [Q9R1V6-13]
ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. [Q9R1V6-3]
ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. [Q9R1V6-6]
GeneID11496.
KEGGmmu:11496.
UCSCuc008wjk.2. mouse. [Q9R1V6-3]
uc008wjv.1. mouse. [Q9R1V6-4]
uc008wjy.1. mouse. [Q9R1V6-2]

Organism-specific databases

CTD53616.
MGIMGI:1340046. Adam22.

Phylogenomic databases

eggNOGNOG256419.
GeneTreeENSGT00680000099751.
HOVERGENHBG050456.
KOK16068.
OMAFSGSQFE.
OrthoDBEOG7B31M6.
PhylomeDBQ9R1V6.
TreeFamTF314733.

Gene expression databases

ArrayExpressQ9R1V6.
BgeeQ9R1V6.
CleanExMM_ADAM22.
GenevestigatorQ9R1V6.

Family and domain databases

Gene3D3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProIPR006586. ADAM_Cys-rich.
IPR001762. Blood-coag_inhib_Disintegrin.
IPR018358. Disintegrin_CS.
IPR000742. EG-like_dom.
IPR013032. EGF-like_CS.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSPR00289. DISINTEGRIN.
SMARTSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
SM00181. EGF. 1 hit.
[Graphical view]
SUPFAMSSF57552. SSF57552. 1 hit.
PROSITEPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
PS50026. EGF_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio278878.
PROQ9R1V6.
SOURCESearch...

Entry information

Entry nameADA22_MOUSE
AccessionPrimary (citable) accession number: Q9R1V6
Secondary accession number(s): Q5TLI8 expand/collapse secondary AC list , Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
Entry history
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: May 2, 2006
Last modified: April 16, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot