Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9R1V6

- ADA22_MOUSE

UniProt

Q9R1V6 - ADA22_MOUSE

Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

Adam22

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 2 (02 May 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation By similarity. Neuronal receptor for LGI1.By similarity1 Publication

    GO - Molecular functioni

    1. metalloendopeptidase activity Source: InterPro
    2. protein binding Source: UniProtKB
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. adult locomotory behavior Source: MGI
    2. gliogenesis Source: MGI
    3. myelination in peripheral nervous system Source: MGI
    4. Schwann cell differentiation Source: MGI

    Keywords - Molecular functioni

    Receptor

    Protein family/group databases

    MEROPSiM12.978.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disintegrin and metalloproteinase domain-containing protein 22
    Short name:
    ADAM 22
    Gene namesi
    Name:Adam22
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:1340046. Adam22.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Disruption phenotypei

    Mice display severe ataxia within one week after birth and die before weaning, probably due to convulsions. They display marked hypomyelination of the peripheral nerves.1 Publication

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi509 – 5091D → N: Fails to bind to LGI1. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323Sequence AnalysisAdd
    BLAST
    Propeptidei24 – 223200By similarityPRO_0000029114Add
    BLAST
    Chaini224 – 904681Disintegrin and metalloproteinase domain-containing protein 22PRO_0000029115Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi163 – 1631N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi347 ↔ 431By similarity
    Disulfide bondi390 ↔ 415By similarity
    Disulfide bondi392 ↔ 399By similarity
    Disulfide bondi445 ↔ 475By similarity
    Disulfide bondi456 ↔ 472By similarity
    Disulfide bondi458 ↔ 464By similarity
    Disulfide bondi471 ↔ 492By similarity
    Disulfide bondi483 ↔ 489By similarity
    Disulfide bondi488 ↔ 514By similarity
    Disulfide bondi501 ↔ 521By similarity
    Disulfide bondi508 ↔ 540By similarity
    Glycosylationi517 – 5171N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi533 ↔ 545By similarity
    Disulfide bondi552 ↔ 603By similarity
    Disulfide bondi567 ↔ 633By similarity
    Disulfide bondi581 ↔ 591By similarity
    Disulfide bondi598 ↔ 661By similarity
    Glycosylationi632 – 6321N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi655 ↔ 666By similarity
    Glycosylationi673 – 6731N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi677 ↔ 692By similarity
    Disulfide bondi686 ↔ 698By similarity
    Disulfide bondi700 ↔ 709By similarity
    Modified residuei832 – 8321PhosphoserineBy similarity

    Post-translational modificationi

    The precursor is cleaved by a furin endopeptidase.By similarity

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ9R1V6.
    PaxDbiQ9R1V6.
    PRIDEiQ9R1V6.

    PTM databases

    PhosphoSiteiQ9R1V6.

    Expressioni

    Tissue specificityi

    Expressed at high levels in the brain. Strongly expressed in cerebellar granule cells and hippocampus. In spinal cord, expression is restricted to gray matter.1 Publication

    Gene expression databases

    ArrayExpressiQ9R1V6.
    BgeeiQ9R1V6.
    CleanExiMM_ADAM22.
    GenevestigatoriQ9R1V6.

    Interactioni

    Subunit structurei

    Interacts with LGI1. Can bind to LGI4.2 Publications

    Protein-protein interaction databases

    IntActiQ9R1V6. 5 interactions.
    MINTiMINT-4086922.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9R1V6.
    SMRiQ9R1V6. Positions 231-716.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini24 – 734711ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini756 – 857102CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei735 – 75521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini237 – 436200Peptidase M12BPROSITE-ProRule annotationAdd
    BLAST
    Domaini442 – 52988DisintegrinPROSITE-ProRule annotationAdd
    BLAST
    Domaini673 – 71038EGF-likePROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi533 – 666134Cys-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 disintegrin domain.PROSITE-ProRule annotation
    Contains 1 EGF-like domain.PROSITE-ProRule annotation
    Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

    Keywords - Domaini

    EGF-like domain, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG256419.
    GeneTreeiENSGT00680000099751.
    HOVERGENiHBG050456.
    KOiK16068.
    OMAiFSGSQFE.
    OrthoDBiEOG7B31M6.
    PhylomeDBiQ9R1V6.
    TreeFamiTF314733.

    Family and domain databases

    Gene3Di3.40.390.10. 1 hit.
    4.10.70.10. 1 hit.
    InterProiIPR006586. ADAM_Cys-rich.
    IPR001762. Blood-coag_inhib_Disintegrin.
    IPR018358. Disintegrin_CS.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR024079. MetalloPept_cat_dom.
    IPR001590. Peptidase_M12B.
    IPR002870. Peptidase_M12B_N.
    [Graphical view]
    PfamiPF08516. ADAM_CR. 1 hit.
    PF00200. Disintegrin. 1 hit.
    PF01562. Pep_M12B_propep. 1 hit.
    PF01421. Reprolysin. 1 hit.
    [Graphical view]
    PRINTSiPR00289. DISINTEGRIN.
    SMARTiSM00608. ACR. 1 hit.
    SM00050. DISIN. 1 hit.
    SM00181. EGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF57552. SSF57552. 1 hit.
    PROSITEiPS50215. ADAM_MEPRO. 1 hit.
    PS00427. DISINTEGRIN_1. 1 hit.
    PS50214. DISINTEGRIN_2. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 1 hit.
    [Graphical view]

    Sequences (21)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 21 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9R1V6-3) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G01, 22g

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP    50
    LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL 100
    DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS 150
    TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS 200
    EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF 250
    KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS 300
    ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL 350
    RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI 400
    MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI 450
    ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV 500
    CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR 550
    QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY 600
    LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE 650
    DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC 700
    NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI 750
    LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK 800
    RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR 850
    PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW 900
    ETSI 904
    Length:904
    Mass (Da):99,715
    Last modified:May 2, 2006 - v2
    Checksum:i0FBBD09398EE0B97
    GO
    Isoform 2 (identifier: Q9R1V6-4) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G03, 22g(D27)

    The sequence of this isoform differs from the canonical sequence as follows:
         766-801: Missing.

    Show »
    Length:868
    Mass (Da):95,927
    Checksum:iC0FA966057D2C5C8
    GO
    Isoform 3 (identifier: Q9R1V6-5) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G06, 22g(D26D27)

    The sequence of this isoform differs from the canonical sequence as follows:
         760-801: Missing.

    Show »
    Length:862
    Mass (Da):95,080
    Checksum:i17E4012489871450
    GO
    Isoform 4 (identifier: Q9R1V6-6) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22=G07, 22g(D26D27)+29.3

    The sequence of this isoform differs from the canonical sequence as follows:
         760-801: Missing.
         857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

    Show »
    Length:899
    Mass (Da):98,855
    Checksum:iDAFB8A148524416E
    GO
    Isoform 5 (identifier: Q9R1V6-7) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G08, 22g(D27)+29.3

    The sequence of this isoform differs from the canonical sequence as follows:
         766-801: Missing.
         857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

    Show »
    Length:905
    Mass (Da):99,702
    Checksum:i6AAA73D541AFB536
    GO
    Isoform 6 (identifier: Q9R1V6-8) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G09, 22g+29.3

    The sequence of this isoform differs from the canonical sequence as follows:
         857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHR

    Show »
    Length:941
    Mass (Da):103,490
    Checksum:iD23B93F0032CBBCF
    GO
    Isoform 7 (identifier: Q9R1V6-9) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G10, 22g+29.1

    The sequence of this isoform differs from the canonical sequence as follows:
         857-904: ETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEGKTAGRQSARLWETSI → DLGIIT

    Show »
    Length:862
    Mass (Da):95,224
    Checksum:i30A066885BBA38FB
    GO
    Isoform 8 (identifier: Q9R1V6-10) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G11, 22g(D27)+29.5+29.7

    The sequence of this isoform differs from the canonical sequence as follows:
         766-801: Missing.
         857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFSSQDSPHQQDR

    Show »
    Length:907
    Mass (Da):100,669
    Checksum:iE228AF65D914F778
    GO
    Isoform 9 (identifier: Q9R1V6-11) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G12, 22g+29.3+29.7

    The sequence of this isoform differs from the canonical sequence as follows:
         857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHRYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

    Show »
    Length:970
    Mass (Da):107,122
    Checksum:iABBCD4AD024F349B
    GO
    Isoform 10 (identifier: Q9R1V6-12) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G17, 22G[27L]+29.3+29.7

    The sequence of this isoform differs from the canonical sequence as follows:
         802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
         857-857: E → EREPQAPEPGHSLAQTIPSQGISPGGSDSPQTGSLDHSSQDGPHQQDR

    Show »
    Length:980
    Mass (Da):107,831
    Checksum:i45BE20975A1D5820
    GO
    Isoform 11 (identifier: Q9R1V6-13) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G18, 22g(D26)[27L]

    The sequence of this isoform differs from the canonical sequence as follows:
         760-765: Missing.
         802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

    Show »
    Length:927
    Mass (Da):102,129
    Checksum:iBD4C6B317C47EFAB
    GO
    Isoform 12 (identifier: Q9R1V6-14) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G19, 22g[27L]+29.5

    The sequence of this isoform differs from the canonical sequence as follows:
         802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS
         857-857: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

    Show »
    Length:962
    Mass (Da):106,608
    Checksum:iD77057A06FD2A7E4
    GO
    Isoform 13 (identifier: Q9R1V6-15) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G20, 22g[27L]

    The sequence of this isoform differs from the canonical sequence as follows:
         802-802: S → SAFLSHFQISTCSITHYSISQNISLFCSRS

    Show »
    Length:933
    Mass (Da):102,976
    Checksum:i1052AC188694EDFC
    GO
    Isoform 14 (identifier: Q9R1V6-16) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G21, 22g(D26)[27S]

    The sequence of this isoform differs from the canonical sequence as follows:
         760-904: NYREQRQLPQ...QSARLWETSI → FPPVPSHIIP...RAPGYGRHPF

    Show »
    Length:883
    Mass (Da):97,640
    Checksum:iC3A2C695E08B72F9
    GO
    Isoform 15 (identifier: Q9R1V6-17) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G22, 22g(D27)+29.7

    The sequence of this isoform differs from the canonical sequence as follows:
         766-801: Missing.
         857-857: E → DSQDGPHQQDR

    Show »
    Length:878
    Mass (Da):97,062
    Checksum:i251D63D6D6CAF0A3
    GO
    Isoform 16 (identifier: Q9R1V6-18) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-G23, 22g(D25D26D27)

    The sequence of this isoform differs from the canonical sequence as follows:
         730-904: VAGTNIIIGI...QSARLWETSI → QMDSLILGVK...RAPGYGRHPF

    Show »
    Length:832
    Mass (Da):92,271
    Checksum:i6BB6F0B5CA150F28
    GO
    Isoform 17 (identifier: Q9R1V6-2) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-A05, Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         766-801: Missing.
         858-904: Missing.

    Show »
    Length:821
    Mass (Da):90,952
    Checksum:i4F8F12B425EB683C
    GO
    Isoform 18 (identifier: Q9R1V6-19) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-A13

    The sequence of this isoform differs from the canonical sequence as follows:
         760-801: Missing.
         858-904: Missing.

    Show »
    Length:815
    Mass (Da):90,105
    Checksum:i59F2A397E25E283F
    GO
    Isoform 19 (identifier: Q9R1V6-20) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-A15

    The sequence of this isoform differs from the canonical sequence as follows:
         760-765: Missing.
         858-904: Missing.

    Show »
    Length:851
    Mass (Da):93,893
    Checksum:iB1A6A8713614459E
    GO
    Isoform 20 (identifier: Q9R1V6-1) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-A04, Alpha

    The sequence of this isoform differs from the canonical sequence as follows:
         858-904: Missing.

    Show »
    Length:857
    Mass (Da):94,740
    Checksum:iCB88FB7000208E09
    GO
    Isoform 21 (identifier: Q9R1V6-21) [UniParc]FASTAAdd to Basket

    Also known as: ADAM22-A16

    The sequence of this isoform differs from the canonical sequence as follows:
         766-846: QLPQGDYVKK...MGGNKKKIRG → FPPVPSHIIP...DLTQLSKLYL
         847-904: Missing.

    Show »
    Length:846
    Mass (Da):93,592
    Checksum:i08A647F010B67028
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti639 – 6391K → R in BAC28742. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei730 – 904175VAGTN…WETSI → QMDSLILGVKGFQTQNIFQT SVKMGDLAVTPGKVTWEATK RKSEGKDLDLDLTQLRPCHL PSLLLHQLGLLPPAENTRTL CLRFQTRGRQRADRAPGYGR HPF in isoform 16. 1 PublicationVSP_018233Add
    BLAST
    Alternative sequencei760 – 904145NYREQ…WETSI → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLRPCH LPSLLLHQLGLLPPAENTRT LCLRFQTRGRQRADRAPGYG RHPF in isoform 14. 1 PublicationVSP_018234Add
    BLAST
    Alternative sequencei760 – 80142Missing in isoform 3, isoform 4 and isoform 18. 1 PublicationVSP_018235Add
    BLAST
    Alternative sequencei760 – 7656Missing in isoform 11 and isoform 19. 1 PublicationVSP_018236
    Alternative sequencei766 – 84681QLPQG…KKIRG → FPPVPSHIIPLVRTFHYFAA GQMDSLILGVKGFQTQNIFQ TSVKMGDLAVTPGKVTWEAT KRKSEGKDLDLDLTQLSKLY L in isoform 21. 1 PublicationVSP_018237Add
    BLAST
    Alternative sequencei766 – 80136Missing in isoform 2, isoform 5, isoform 8, isoform 15 and isoform 17. 3 PublicationsVSP_018238Add
    BLAST
    Alternative sequencei802 – 8021S → SAFLSHFQISTCSITHYSIS QNISLFCSRS in isoform 10, isoform 11, isoform 12 and isoform 13. 1 PublicationVSP_018239
    Alternative sequencei847 – 90458Missing in isoform 21. 1 PublicationVSP_018240Add
    BLAST
    Alternative sequencei857 – 90448ETLSP…WETSI → DLGIIT in isoform 7. 1 PublicationVSP_018241Add
    BLAST
    Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHSSQ DGPHQQDR in isoform 10. 1 PublicationVSP_018242
    Alternative sequencei857 – 8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 12. 1 PublicationVSP_018243
    Alternative sequencei857 – 8571E → DSQDGPHQQDR in isoform 15. 1 PublicationVSP_018244
    Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHR in isoform 4, isoform 5 and isoform 6. 1 PublicationVSP_018245
    Alternative sequencei857 – 8571E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFSSQDSPHQQDR in isoform 8. 1 PublicationVSP_018246
    Alternative sequencei857 – 8571E → EREPQAPEPGHSLAQTIPSQ GISPGGSDSPQTGSLDHRYL NPWFKRDYNVAKWVEDVNKN TEGPYFR in isoform 9. 1 PublicationVSP_018247
    Alternative sequencei858 – 90447Missing in isoform 17, isoform 18, isoform 19 and isoform 20. 2 PublicationsVSP_018248Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009674 mRNA. Translation: BAA83382.1.
    AB009674 mRNA. Translation: BAA83383.1.
    AK034528 mRNA. Translation: BAC28742.1.
    AB179842 mRNA. Translation: BAD72803.1.
    AB179843 mRNA. Translation: BAD72804.1.
    AB179844 mRNA. Translation: BAD72805.1.
    AB179845 mRNA. Translation: BAD72806.1.
    AB179846 mRNA. Translation: BAD72807.1.
    AB179847 mRNA. Translation: BAD72808.1.
    AB179848 mRNA. Translation: BAD72809.1.
    AB179849 mRNA. Translation: BAD72810.1.
    AB179850 mRNA. Translation: BAD72811.1.
    AB179851 mRNA. Translation: BAD72812.1.
    AB179852 mRNA. Translation: BAD72813.1.
    AB179853 mRNA. Translation: BAD72814.1.
    AB179854 mRNA. Translation: BAD72815.1.
    AB179855 mRNA. Translation: BAD72816.1.
    AB179856 mRNA. Translation: BAD72817.1.
    AB179857 mRNA. Translation: BAD72818.1.
    AB179858 mRNA. Translation: BAD72819.1.
    AB179859 mRNA. Translation: BAD72820.1.
    AB179860 mRNA. Translation: BAD72821.1.
    AB179861 mRNA. Translation: BAD72822.1.
    AB179862 mRNA. Translation: BAD72823.1.
    CCDSiCCDS19080.1. [Q9R1V6-1]
    CCDS51411.1. [Q9R1V6-4]
    RefSeqiNP_001007221.1. NM_001007220.2. [Q9R1V6-1]
    NP_001007222.1. NM_001007221.2. [Q9R1V6-2]
    NP_001091695.1. NM_001098225.1. [Q9R1V6-4]
    XP_006503592.1. XM_006503529.1. [Q9R1V6-12]
    XP_006503593.1. XM_006503530.1. [Q9R1V6-11]
    XP_006503594.1. XM_006503531.1. [Q9R1V6-14]
    XP_006503596.1. XM_006503533.1. [Q9R1V6-8]
    XP_006503598.1. XM_006503535.1. [Q9R1V6-15]
    XP_006503600.1. XM_006503537.1. [Q9R1V6-7]
    XP_006503601.1. XM_006503538.1. [Q9R1V6-3]
    XP_006503602.1. XM_006503539.1. [Q9R1V6-6]
    XP_006503605.1. XM_006503542.1. [Q9R1V6-5]
    UniGeneiMm.275895.

    Genome annotation databases

    EnsembliENSMUST00000046838; ENSMUSP00000049120; ENSMUSG00000040537. [Q9R1V6-1]
    ENSMUST00000050166; ENSMUSP00000055000; ENSMUSG00000040537. [Q9R1V6-4]
    ENSMUST00000088744; ENSMUSP00000086122; ENSMUSG00000040537. [Q9R1V6-13]
    ENSMUST00000088761; ENSMUSP00000086139; ENSMUSG00000040537. [Q9R1V6-3]
    ENSMUST00000115388; ENSMUSP00000111046; ENSMUSG00000040537. [Q9R1V6-6]
    GeneIDi11496.
    KEGGimmu:11496.
    UCSCiuc008wjk.2. mouse. [Q9R1V6-3]
    uc008wjv.1. mouse. [Q9R1V6-4]
    uc008wjy.1. mouse. [Q9R1V6-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB009674 mRNA. Translation: BAA83382.1 .
    AB009674 mRNA. Translation: BAA83383.1 .
    AK034528 mRNA. Translation: BAC28742.1 .
    AB179842 mRNA. Translation: BAD72803.1 .
    AB179843 mRNA. Translation: BAD72804.1 .
    AB179844 mRNA. Translation: BAD72805.1 .
    AB179845 mRNA. Translation: BAD72806.1 .
    AB179846 mRNA. Translation: BAD72807.1 .
    AB179847 mRNA. Translation: BAD72808.1 .
    AB179848 mRNA. Translation: BAD72809.1 .
    AB179849 mRNA. Translation: BAD72810.1 .
    AB179850 mRNA. Translation: BAD72811.1 .
    AB179851 mRNA. Translation: BAD72812.1 .
    AB179852 mRNA. Translation: BAD72813.1 .
    AB179853 mRNA. Translation: BAD72814.1 .
    AB179854 mRNA. Translation: BAD72815.1 .
    AB179855 mRNA. Translation: BAD72816.1 .
    AB179856 mRNA. Translation: BAD72817.1 .
    AB179857 mRNA. Translation: BAD72818.1 .
    AB179858 mRNA. Translation: BAD72819.1 .
    AB179859 mRNA. Translation: BAD72820.1 .
    AB179860 mRNA. Translation: BAD72821.1 .
    AB179861 mRNA. Translation: BAD72822.1 .
    AB179862 mRNA. Translation: BAD72823.1 .
    CCDSi CCDS19080.1. [Q9R1V6-1 ]
    CCDS51411.1. [Q9R1V6-4 ]
    RefSeqi NP_001007221.1. NM_001007220.2. [Q9R1V6-1 ]
    NP_001007222.1. NM_001007221.2. [Q9R1V6-2 ]
    NP_001091695.1. NM_001098225.1. [Q9R1V6-4 ]
    XP_006503592.1. XM_006503529.1. [Q9R1V6-12 ]
    XP_006503593.1. XM_006503530.1. [Q9R1V6-11 ]
    XP_006503594.1. XM_006503531.1. [Q9R1V6-14 ]
    XP_006503596.1. XM_006503533.1. [Q9R1V6-8 ]
    XP_006503598.1. XM_006503535.1. [Q9R1V6-15 ]
    XP_006503600.1. XM_006503537.1. [Q9R1V6-7 ]
    XP_006503601.1. XM_006503538.1. [Q9R1V6-3 ]
    XP_006503602.1. XM_006503539.1. [Q9R1V6-6 ]
    XP_006503605.1. XM_006503542.1. [Q9R1V6-5 ]
    UniGenei Mm.275895.

    3D structure databases

    ProteinModelPortali Q9R1V6.
    SMRi Q9R1V6. Positions 231-716.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9R1V6. 5 interactions.
    MINTi MINT-4086922.

    Protein family/group databases

    MEROPSi M12.978.

    PTM databases

    PhosphoSitei Q9R1V6.

    Proteomic databases

    MaxQBi Q9R1V6.
    PaxDbi Q9R1V6.
    PRIDEi Q9R1V6.

    Protocols and materials databases

    DNASUi 11496.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000046838 ; ENSMUSP00000049120 ; ENSMUSG00000040537 . [Q9R1V6-1 ]
    ENSMUST00000050166 ; ENSMUSP00000055000 ; ENSMUSG00000040537 . [Q9R1V6-4 ]
    ENSMUST00000088744 ; ENSMUSP00000086122 ; ENSMUSG00000040537 . [Q9R1V6-13 ]
    ENSMUST00000088761 ; ENSMUSP00000086139 ; ENSMUSG00000040537 . [Q9R1V6-3 ]
    ENSMUST00000115388 ; ENSMUSP00000111046 ; ENSMUSG00000040537 . [Q9R1V6-6 ]
    GeneIDi 11496.
    KEGGi mmu:11496.
    UCSCi uc008wjk.2. mouse. [Q9R1V6-3 ]
    uc008wjv.1. mouse. [Q9R1V6-4 ]
    uc008wjy.1. mouse. [Q9R1V6-2 ]

    Organism-specific databases

    CTDi 53616.
    MGIi MGI:1340046. Adam22.

    Phylogenomic databases

    eggNOGi NOG256419.
    GeneTreei ENSGT00680000099751.
    HOVERGENi HBG050456.
    KOi K16068.
    OMAi FSGSQFE.
    OrthoDBi EOG7B31M6.
    PhylomeDBi Q9R1V6.
    TreeFami TF314733.

    Miscellaneous databases

    NextBioi 278878.
    PROi Q9R1V6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9R1V6.
    Bgeei Q9R1V6.
    CleanExi MM_ADAM22.
    Genevestigatori Q9R1V6.

    Family and domain databases

    Gene3Di 3.40.390.10. 1 hit.
    4.10.70.10. 1 hit.
    InterProi IPR006586. ADAM_Cys-rich.
    IPR001762. Blood-coag_inhib_Disintegrin.
    IPR018358. Disintegrin_CS.
    IPR000742. EG-like_dom.
    IPR013032. EGF-like_CS.
    IPR024079. MetalloPept_cat_dom.
    IPR001590. Peptidase_M12B.
    IPR002870. Peptidase_M12B_N.
    [Graphical view ]
    Pfami PF08516. ADAM_CR. 1 hit.
    PF00200. Disintegrin. 1 hit.
    PF01562. Pep_M12B_propep. 1 hit.
    PF01421. Reprolysin. 1 hit.
    [Graphical view ]
    PRINTSi PR00289. DISINTEGRIN.
    SMARTi SM00608. ACR. 1 hit.
    SM00050. DISIN. 1 hit.
    SM00181. EGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57552. SSF57552. 1 hit.
    PROSITEi PS50215. ADAM_MEPRO. 1 hit.
    PS00427. DISINTEGRIN_1. 1 hit.
    PS50214. DISINTEGRIN_2. 1 hit.
    PS00022. EGF_1. 1 hit.
    PS50026. EGF_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and chromosomal mapping of mouse ADAM11, ADAM22 and ADAM23."
      Sagane K., Yamazaki K., Mizui Y., Tanaka I.
      Gene 236:79-86(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 17 AND 20).
      Tissue: Brain.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 619-904 (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Embryo.
    3. "Ataxia and peripheral nerve hypomyelination in ADAM22-deficient mice."
      Sagane K., Hayakawa K., Kai J., Hirohashi T., Takahashi E., Miyamoto N., Ino M., Oki T., Yamazaki K., Nagasu T.
      BMC Neurosci. 6:33-33(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 709-904 (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14; 15; 16; 17; 18; 19; 20 AND 21), TISSUE SPECIFICITY, DISRUPTION PHENOTYPE.
    4. "Epilepsy-related ligand/receptor complex LGI1 and ADAM22 regulate synaptic transmission."
      Fukata Y., Adesnik H., Iwanaga T., Bredt D.S., Nicoll R.A., Fukata M.
      Science 313:1792-1795(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH LGI1, MUTAGENESIS OF ASP-509.
    5. "LGI1 and LGI4 bind to ADAM22, ADAM23 and ADAM11."
      Sagane K., Ishihama Y., Sugimoto H.
      Int. J. Biol. Sci. 4:387-396(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LIGI1 AND LGI4.

    Entry informationi

    Entry nameiADA22_MOUSE
    AccessioniPrimary (citable) accession number: Q9R1V6
    Secondary accession number(s): Q5TLI8
    , Q5TLI9, Q5TLJ0, Q5TLJ1, Q5TLJ2, Q5TLJ3, Q5TLJ4, Q5TLJ5, Q5TLJ6, Q5TLJ7, Q5TLJ8, Q5TLJ9, Q5TLK0, Q5TLK1, Q5TLK2, Q5TLK3, Q5TLK4, Q5TLK5, Q5TLK6, Q5TLK7, Q5TLK8, Q8BSF2, Q9R1V5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 20, 2001
    Last sequence update: May 2, 2006
    Last modified: October 1, 2014
    This is version 125 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3