Q9R1T2 (SAE1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SUMO-activating enzyme subunit 1 Alternative name(s): Ubiquitin-like 1-activating enzyme E1A | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 350 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | The heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2 By similarity. |
| Pathway | |
| Subunit structure | Heterodimer of SAE1 and UBA2/SAE2. The heterodimer corresponds to the two domains that are encoded on a single polypeptide chain in ubiquitin-activating enzyme E1. Interacts with UBE2I By similarity. |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Broadly expressed, with highest levels in testis. Ref.4 |
| Sequence similarities | Belongs to the ubiquitin-activating E1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Ligase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein sumoylation Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | SUMO activating enzyme activity Inferred from electronic annotation. Source: Compara ligase activityInferred from electronic annotation. Source: UniProtKB-KW nucleotide bindingInferred from electronic annotation. Source: InterPro protein C-terminus bindingInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9R1T2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9R1T2-2) The sequence of this isoform differs from the canonical sequence as follows: 321-350: ALSQRDPPHNNFFFFDGMKGSGIVECLGPQ → VCLGTMCV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mus musculus cDNA similar to human Sua1 complete cds, complete cds." Kaneta Y., Takada S., Itoh M., Takagi N. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: BALB/c, C57BL/6J and NOD. Tissue: Embryo, Embryonic stem cell, Eye and Thymus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain. |
| [4] | "Expression and regulation of the mammalian SUMO-1 E1 enzyme." Azuma Y., Tan S.-H., Cavenagh M.M., Ainsztein A.M., Saitoh H., Dasso M. FASEB J. 15:1825-1827(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB024303 mRNA. Translation: BAA82876.1. AK010313 mRNA. Translation: BAB26845.1. AK011783 mRNA. Translation: BAB27838.1. AK087556 mRNA. Translation: BAC39925.1. AK090012 mRNA. Translation: BAC41044.1. AK154139 mRNA. Translation: BAE32401.1. AK159672 mRNA. Translation: BAE35276.1. AK162789 mRNA. Translation: BAE37060.1. BC068164 mRNA. Translation: AAH68164.1. |
| IPI | IPI00129105. IPI00816839. |
| RefSeq | NP_062722.1. NM_019748.2. |
| UniGene | Mm.258530. |
3D structure databases | |
| ProteinModelPortal | Q9R1T2. |
| SMR | Q9R1T2. Positions 29-349. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9R1T2. |
2D gel databases | |
| REPRODUCTION-2DPAGE | Q9R1T2. |
Proteomic databases | |
| PaxDb | Q9R1T2. |
| PRIDE | Q9R1T2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000094815; ENSMUSP00000092409; ENSMUSG00000052833. |
| GeneID | 56459. |
| KEGG | mmu:56459. |
| UCSC | uc009fhp.1. mouse. uc009fhq.1. mouse. |
Organism-specific databases | |
| CTD | 10055. |
| MGI | MGI:1929264. Sae1. |
Phylogenomic databases | |
| eggNOG | COG0476. |
| GeneTree | ENSGT00550000075007. |
| HOGENOM | HOG000172217. |
| HOVERGEN | HBG080782. |
| InParanoid | Q9R1T2. |
| KO | K10684. |
| OMA | GSGIVEC. |
| OrthoDB | EOG4FTW0X. |
Enzyme and pathway databases | |
| UniPathway | UPA00886. |
Gene expression databases | |
| Bgee | Q9R1T2. |
| CleanEx | MM_SAE1. |
| Genevestigator | Q9R1T2. |
| GermOnline | ENSMUSG00000052833. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.40.50.720. 1 hit. |
| InterPro | IPR009036. Molybdenum_cofac_synth_MoeB. IPR016040. NAD(P)-bd_dom. IPR000594. ThiF_NAD_FAD-bd. IPR000011. UBQ/SUMO-activ_enz_E1-like. [Graphical view] |
| Pfam | PF00899. ThiF. 1 hit. [Graphical view] |
| PRINTS | PR01849. UBIQUITINACT. |
| SUPFAM | SSF69572. MoeB. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 312702. |
| SOURCE | Search... |
Entry information
| Entry name | SAE1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9R1T2 Secondary accession number(s): Q3TRG9, Q3TWJ0, Q9CSW9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
