Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SUMO-activating enzyme subunit 1

Gene

Sae1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2 (By similarity).By similarity

Pathwayi: protein sumoylation

This protein is involved in the pathway protein sumoylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein sumoylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionLigase
Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-MMU-3065676. SUMO is conjugated to E1 (UBA2:SAE1).
R-MMU-3065678. SUMO is transferred from E1 to E2 (UBE2I, UBC9).
UniPathwayiUPA00886.

Names & Taxonomyi

Protein namesi
Recommended name:
SUMO-activating enzyme subunit 1
Alternative name(s):
Ubiquitin-like 1-activating enzyme E1A
Cleaved into the following chain:
Gene namesi
Name:Sae1
Synonyms:Aos1, Sua1, Ubl1a1, Uble1a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1929264. Sae1.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004232911 – 350SUMO-activating enzyme subunit 1Add BLAST350
Initiator methionineiRemoved; alternateBy similarity
ChainiPRO_00001949672 – 350SUMO-activating enzyme subunit 1, N-terminally processedAdd BLAST349

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei2N-acetylvaline; in SUMO-activating enzyme subunit 1, N-terminally processedBy similarity1
Modified residuei16PhosphoserineBy similarity1
Modified residuei202N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9R1T2.
PaxDbiQ9R1T2.
PeptideAtlasiQ9R1T2.
PRIDEiQ9R1T2.

2D gel databases

REPRODUCTION-2DPAGEiQ9R1T2.

PTM databases

iPTMnetiQ9R1T2.
PhosphoSitePlusiQ9R1T2.
SwissPalmiQ9R1T2.

Expressioni

Tissue specificityi

Broadly expressed, with highest levels in testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000052833.
CleanExiMM_SAE1.
GenevisibleiQ9R1T2. MM.

Interactioni

Subunit structurei

Heterodimer of SAE1 and UBA2/SAE2. The heterodimer corresponds to the two domains that are encoded on a single polypeptide chain in ubiquitin-activating enzyme E1. Interacts with UBE2I (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi207998. 1 interactor.
IntActiQ9R1T2. 1 interactor.
MINTiMINT-4139487.
STRINGi10090.ENSMUSP00000092409.

Structurei

3D structure databases

ProteinModelPortaliQ9R1T2.
SMRiQ9R1T2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ubiquitin-activating E1 family.Curated

Phylogenomic databases

eggNOGiKOG2014. Eukaryota.
COG0476. LUCA.
GeneTreeiENSGT00550000075007.
HOGENOMiHOG000172217.
HOVERGENiHBG080782.
InParanoidiQ9R1T2.
KOiK10684.
OMAiSYCFSEM.
OrthoDBiEOG091G0DZ1.
PhylomeDBiQ9R1T2.
TreeFamiTF315037.

Family and domain databases

InterProiView protein in InterPro
IPR000594. ThiF_NAD_FAD-bd.
IPR035985. Ubiquitin-activating_enz.
IPR000011. UBQ/SUMO-activ_enz_E1-like.
PfamiView protein in Pfam
PF00899. ThiF. 1 hit.
PRINTSiPR01849. UBIQUITINACT.
SUPFAMiSSF69572. SSF69572. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9R1T2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVEKEEAGGG GGGGISEEEA AQYDRQIRLW GLEAQKRLRA SRVLIVGMKG
60 70 80 90 100
LGAEIAKNLI LAGVKGLTML DHEQVSPEDP GAQFLIQTGS VGRNRAEASL
110 120 130 140 150
ERAQNLNPMV DVKVDTEDVE KKPESFFTKF DAVCLTCCSR DVIIKVDQIC
160 170 180 190 200
HRNSIKFFTG DVFGYHGYTF ANLGEHEFVE EKTKVAKVSQ GVEDGPEAKR
210 220 230 240 250
AKLDSSETTM VKKKVLFCPV KEALEVDWSG EKAKAALKRT APDYFLLQVL
260 270 280 290 300
LKFRTDKGRD PTSESYKEDA ELLLQIRNDV FDSLGISPDL LPDDFVRYCF
310 320 330 340 350
SEMAPVCAVV GGILAQEIVK ALSQRDPPHN NFFFFDGMKG SGIVECLGPQ
Length:350
Mass (Da):38,620
Last modified:May 1, 2000 - v1
Checksum:i333108F6E98BABAA
GO
Isoform 2 (identifier: Q9R1T2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     321-350: ALSQRDPPHNNFFFFDGMKGSGIVECLGPQ → VCLGTMCV

Note: No experimental confirmation available.
Show »
Length:328
Mass (Da):36,135
Checksum:iD979A4D5950C2E4F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022004321 – 350ALSQR…CLGPQ → VCLGTMCV in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB024303 mRNA. Translation: BAA82876.1.
AK010313 mRNA. Translation: BAB26845.1.
AK011783 mRNA. Translation: BAB27838.1.
AK087556 mRNA. Translation: BAC39925.1.
AK090012 mRNA. Translation: BAC41044.1.
AK154139 mRNA. Translation: BAE32401.1.
AK159672 mRNA. Translation: BAE35276.1.
AK162789 mRNA. Translation: BAE37060.1.
BC068164 mRNA. Translation: AAH68164.1.
CCDSiCCDS20848.1. [Q9R1T2-1]
CCDS85221.1. [Q9R1T2-2]
RefSeqiNP_001272820.1. NM_001285891.1. [Q9R1T2-1]
NP_001272821.1. NM_001285892.1. [Q9R1T2-2]
NP_062722.1. NM_019748.3. [Q9R1T2-1]
UniGeneiMm.258530.

Genome annotation databases

EnsembliENSMUST00000094815; ENSMUSP00000092409; ENSMUSG00000052833. [Q9R1T2-1]
ENSMUST00000210999; ENSMUSP00000147409; ENSMUSG00000052833. [Q9R1T2-1]
ENSMUST00000211741; ENSMUSP00000147771; ENSMUSG00000052833. [Q9R1T2-2]
GeneIDi56459.
KEGGimmu:56459.
UCSCiuc009fhp.2. mouse. [Q9R1T2-1]
uc009fhq.2. mouse. [Q9R1T2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSAE1_MOUSE
AccessioniPrimary (citable) accession number: Q9R1T2
Secondary accession number(s): Q3TRG9, Q3TWJ0, Q9CSW9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: May 1, 2000
Last modified: October 25, 2017
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families