Q9R1R0 (LHX6_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LIM/homeobox protein Lhx6 Short name=LIM homeobox protein 6 Alternative name(s): LIM/homeobox protein Lhx6.1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 363 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex. Ref.2 Ref.5 Ref.7 Ref.8 Ref.9 |
| Subunit structure | Interacts with LDB1 (via the LIM zinc-binding domains). Ref.2 |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Brain specific. Expressed by neurons in the amygdala that are activated by reproductive olfactory stimuli and project in regions of the hypothalamus involved in reproduction (at protein level). Ref.2 Ref.6 |
| Developmental stage | Specifically expressed during brain maturation from E14.5 to P2 by a subset of tangentially migrating interneurons. Barely detectable in adult brain. Isoform 1 expression peaks at P2 and remains high in adulthood compared to isoform 2. Expressed in preoptic area, hypothalamic regions and the first branchial arch at E9.5. Expressed uniformly in the odontogenic mesenchyme of the first branchial arch prior to initiation of tooth development. During odontogenesis expression is restricted to the mesenchyme participating in the formation of individual teeth. Expressed in olfactory bulb, arcuate nucleus, medial glanglionic eminence and preoptic area at E13.5 and E14.5. Expression spread to the cortex and hippocampus at P1.0. Preferentially expressed in parvalbumin or somatostatin positive cortical interneurons. Ref.1 Ref.2 Ref.4 Ref.7 Ref.9 |
| Disruption phenotype | Mice lacking Lhx6 fail to thrive, develop general weakness and die within the first 2 weeks after birth. Ref.7 Ref.9 |
| Sequence similarities | Contains 1 homeobox DNA-binding domain. Contains 2 LIM zinc-binding domains. |
| Sequence caution | The sequence CAA04011.1 differs from that shown. Reason: Several sequencing errors. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9R1R0-1) Also known as: Lhx6.1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9R1R0-2) Also known as: Lhx6.1b; The sequence of this isoform differs from the canonical sequence as follows: 324-363: QVQCGQVHCRLPYTAPPVHLKADLDGPLSSRGEKVILFQY → HPFSVLTLPALAHLSMGTTQLPLSR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 363 | 363 | LIM/homeobox protein Lhx6 | PRO_0000075795 | |||||
Regions | |||||||||
| Domain | 70 – 122 | 53 | LIM zinc-binding 1 | ||||||
| Domain | 131 – 184 | 54 | LIM zinc-binding 2 | ||||||
| DNA binding | 219 – 278 | 60 | Homeobox | ||||||
| Region | 55 – 194 | 140 | Required for interaction with LDB1 | ||||||
Natural variations | |||||||||
| Alternative sequence | 324 – 363 | 40 | QVQCG…ILFQY → HPFSVLTLPALAHLSMGTTQ LPLSR in isoform 2. | VSP_003110 | |||||
Experimental info | |||||||||
| Sequence conflict | 19 | 1 | A → T in BAA83420. Ref.2 | ||||||
| Sequence conflict | 19 | 1 | A → T in BAA83421. Ref.2 | ||||||
| Sequence conflict | 194 | 1 | R → K in BAA83420. Ref.2 | ||||||
| Sequence conflict | 194 | 1 | R → K in BAA83421. Ref.2 | ||||||
| Sequence conflict | 258 | 1 | L → F in BAA83420. Ref.2 | ||||||
| Sequence conflict | 258 | 1 | L → F in BAA83421. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression and regulation of Lhx6 and Lhx7, a novel subfamily of LIM homeodomain encoding genes, suggests a role in mammalian head development." Grigoriou M., Tucker A.S., Sharpe P.T., Pachnis V. Development 125:2063-2074(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DEVELOPMENTAL STAGE. |
| [2] | "A brain region-specific gene product Lhx6.1 interacts with Ldb1 through tandem LIM-domains." Kimura N., Ueno M., Nakashima K., Taga T. J. Biochem. 126:180-187(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH LDB1, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE (ISOFORMS 1 AND 2). Tissue: Fetal brain. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6. Tissue: Brain. |
| [4] | "The medial ganglionic eminence gives rise to a population of early neurons in the developing cerebral cortex." Lavdas A.A., Grigoriou M., Pachnis V., Parnavelas J.G. J. Neurosci. 19:7881-7888(1999) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [5] | "Lhx6 regulates the migration of cortical interneurons from the ventral telencephalon but does not specify their GABA phenotype." Alifragis P., Liapi A., Parnavelas J.G. J. Neurosci. 24:5643-5648(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [6] | "Lhx6 delineates a pathway mediating innate reproductive behaviors from the amygdala to the hypothalamus." Choi G.B., Dong H.-W., Murphy A.J., Valenzuela D.M., Yancopoulos G.D., Swanson L.W., Anderson D.J. Neuron 46:647-660(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [7] | "Lhx6 activity is required for the normal migration and specification of cortical interneuron subtypes." Liodis P., Denaxa M., Grigoriou M., Akufo-Addo C., Yanagawa Y., Pachnis V. J. Neurosci. 27:3078-3089(2007) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION, DEVELOPMENTAL STAGE. |
| [8] | "NKX2.1 specifies cortical interneuron fate by activating Lhx6." Du T., Xu Q., Ocbina P.J., Anderson S.A. Development 135:1559-1567(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Distinct molecular pathways for development of telencephalic interneuron subtypes revealed through analysis of Lhx6 mutants." Zhao Y., Flandin P., Long J.E., Cuesta M.D., Westphal H., Rubenstein J.L.R. J. Comp. Neurol. 510:79-99(2008) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE, FUNCTION, DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ000337 mRNA. Translation: CAA04011.1. Sequence problems. AB031040 mRNA. Translation: BAA83421.1. AB031039 mRNA. Translation: BAA83420.1. AL773525 Genomic DNA. Translation: CAM16137.1. BC065077 mRNA. Translation: AAH65077.1. |
| IPI | IPI00457813. IPI00457814. |
| RefSeq | NP_001076595.1. NM_001083126.1. NP_001076596.1. NM_001083127.1. NP_032526.2. NM_008500.2. |
| UniGene | Mm.12881. |
3D structure databases | |
| ProteinModelPortal | Q9R1R0. |
| SMR | Q9R1R0. Positions 69-187, 214-277. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q9R1R0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000112961; ENSMUSP00000108585; ENSMUSG00000026890. ENSMUST00000112963; ENSMUSP00000108587; ENSMUSG00000026890. ENSMUST00000112966; ENSMUSP00000108590; ENSMUSG00000026890. ENSMUST00000148852; ENSMUSP00000135693; ENSMUSG00000026890. |
| GeneID | 16874. |
| KEGG | mmu:16874. |
| UCSC | uc008jld.1. mouse. |
Organism-specific databases | |
| CTD | 26468. |
| MGI | MGI:1306803. Lhx6. |
Phylogenomic databases | |
| eggNOG | NOG264882. |
| GeneTree | ENSGT00700000104050. |
| HOGENOM | HOG000038965. |
| HOVERGEN | HBG006261. |
| InParanoid | Q6P1H2. |
| KO | K09375. |
| OrthoDB | EOG4GTKD8. |
Gene expression databases | |
| ArrayExpress | Q9R1R0. |
| Bgee | Q9R1R0. |
| Genevestigator | Q9R1R0. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 1 hit. 2.10.110.10. 2 hits. |
| InterPro | IPR017970. Homeobox_CS. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR001781. Znf_LIM. [Graphical view] |
| Pfam | PF00046. Homeobox. 1 hit. PF00412. LIM. 2 hits. [Graphical view] |
| SMART | SM00389. HOX. 1 hit. SM00132. LIM. 2 hits. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS00478. LIM_DOMAIN_1. 2 hits. PS50023. LIM_DOMAIN_2. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 290850. |
| SOURCE | Search... |
Entry information
| Entry name | LHX6_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9R1R0 Secondary accession number(s): O88706, Q6P1H2, Q9R1R1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
