Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium bicarbonate cotransporter 3

Gene

Slc4a7

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na+:HCO3- 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.1 Publication

Enzyme regulationi

Transporter activity is regulated by CA2/carbonic anhydrase 2, cAMP and PKA. Insensitive to stilbene derivatives. May be inhibited by 5-(N-ethyl-N-isopropyl)-amiloride (EIPA) (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Sodium transport, Symport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiR-RNO-425381. Bicarbonate transporters.

Protein family/group databases

TCDBi2.A.31.2.1. the anion exchanger (ae) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium bicarbonate cotransporter 3
Alternative name(s):
Electroneutral sodium bicarbonate cotransporter 1
NBC-like protein
Solute carrier family 4 member 7
Gene namesi
Name:Slc4a7
Synonyms:Nbc, Nbc2, Nbc3, Nbcn1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 15

Organism-specific databases

RGDi621208. Slc4a7.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 612ExtracellularSequence analysisAdd BLAST612
Transmembranei613 – 633HelicalSequence analysisAdd BLAST21
Topological domaini634 – 641CytoplasmicSequence analysis8
Transmembranei642 – 662HelicalSequence analysisAdd BLAST21
Topological domaini663 – 699ExtracellularSequence analysisAdd BLAST37
Transmembranei700 – 720HelicalSequence analysisAdd BLAST21
Topological domaini721 – 729CytoplasmicSequence analysis9
Transmembranei730 – 750HelicalSequence analysisAdd BLAST21
Topological domaini751 – 821ExtracellularSequence analysisAdd BLAST71
Transmembranei822 – 842HelicalSequence analysisAdd BLAST21
Topological domaini843 – 865CytoplasmicSequence analysisAdd BLAST23
Transmembranei866 – 886HelicalSequence analysisAdd BLAST21
Topological domaini887 – 912ExtracellularSequence analysisAdd BLAST26
Transmembranei913 – 933HelicalSequence analysisAdd BLAST21
Topological domaini934 – 958CytoplasmicSequence analysisAdd BLAST25
Transmembranei959 – 979HelicalSequence analysisAdd BLAST21
Topological domaini980 – 1015ExtracellularSequence analysisAdd BLAST36
Transmembranei1016 – 1036HelicalSequence analysisAdd BLAST21
Topological domaini1037 – 1038CytoplasmicSequence analysis2
Transmembranei1039 – 1059HelicalSequence analysisAdd BLAST21
Topological domaini1060 – 1096ExtracellularSequence analysisAdd BLAST37
Transmembranei1097 – 1117HelicalSequence analysisAdd BLAST21
Topological domaini1118 – 1218CytoplasmicSequence analysisAdd BLAST101

GO - Cellular componenti

  • apical plasma membrane Source: UniProtKB
  • basolateral plasma membrane Source: UniProtKB
  • cytoplasmic vesicle Source: UniProtKB
  • integral component of plasma membrane Source: GO_Central
  • plasma membrane Source: RGD
  • stereocilium Source: RGD
  • synapse Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000792351 – 1218Sodium bicarbonate cotransporter 3Add BLAST1218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei57PhosphoserineBy similarity1
Modified residuei60PhosphoserineBy similarity1
Modified residuei89PhosphoserineCombined sources1
Modified residuei155PhosphoserineCombined sources1
Glycosylationi176N-linked (GlcNAc...)Sequence analysis1
Modified residuei238PhosphoserineBy similarity1
Modified residuei247PhosphoserineCombined sources1
Glycosylationi274N-linked (GlcNAc...)Sequence analysis1
Modified residuei386PhosphoserineBy similarity1
Modified residuei404PhosphoserineCombined sources1
Modified residuei407PhosphoserineCombined sources1
Glycosylationi410N-linked (GlcNAc...)Sequence analysis1
Modified residuei411PhosphoserineBy similarity1
Modified residuei560PhosphoserineBy similarity1
Disulfide bondi770 ↔ 772By similarity
Glycosylationi780N-linked (GlcNAc...)Sequence analysis1
Glycosylationi790N-linked (GlcNAc...)Sequence analysis1
Glycosylationi800N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi806 ↔ 818By similarity
Modified residuei1171PhosphothreonineBy similarity1
Modified residuei1180PhosphoserineBy similarity1
Modified residuei1217PhosphoserineBy similarity1
Isoform 4 (identifier: Q9R1N3-4)
Modified residuei263PhosphoserineCombined sources1
Modified residuei1078PhosphoserineCombined sources1
Isoform 6 (identifier: Q9R1N3-6)
Modified residuei263PhosphoserineCombined sources1
Isoform 5 (identifier: Q9R1N3-5)
Modified residuei1067PhosphoserineCombined sources1
Isoform 3 (identifier: Q9R1N3-3)
Modified residuei1188PhosphoserineCombined sources1
Isoform 2 (identifier: Q9R1N3-2)
Modified residuei1201PhosphoserineCombined sources1

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9R1N3.
PRIDEiQ9R1N3.

PTM databases

iPTMnetiQ9R1N3.
PhosphoSitePlusiQ9R1N3.
SwissPalmiQ9R1N3.

Expressioni

Tissue specificityi

Expressed in aorta, ventricles, atrium, mesenteric artery, kidney, spleen, duodenum, jejunum, ileum, colon, lung, trachea, gastric fundus and pylorus, cerebrum, cerebellum, pancreas, liver, parotid gland, and epididymis. Expressed in the inner ear by cochlear outer and inner hair cells (at protein level). Highly expressed in testis and spleen. Also detected in heart, brain, lung, liver and kidney. Isoform 4 and isoform 5 are specifically expressed in kidney. Isoform 6 is specifically expressed in hippocampal neurons.5 Publications

Inductioni

Up-regulated in kidney upon metabolic acidosis.1 Publication

Gene expression databases

BgeeiENSRNOG00000005957.
ExpressionAtlasiQ9R1N3. baseline and differential.
GenevisibleiQ9R1N3. RN.

Interactioni

Subunit structurei

Interacts with USH1C. Forms a complex with ATP6V1B1 and SLC9A3R1/EBP50. Interacts in a pH dependent-manner with CA2/carbonic anhydrase 2 (By similarity). Interacts with CFTR probably through SLC9A3R1/EBP50.By similarity1 Publication

Protein-protein interaction databases

BioGridi250777. 1 interactor.
STRINGi10116.ENSRNOP00000008759.

Structurei

3D structure databases

ProteinModelPortaliQ9R1N3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1138 – 1140CA2-bindingBy similarity3

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1215 – 1218PDZ-bindingBy similarity4

Domaini

The PDZ-binding motif mediates interaction with the CFTR, SLC9A3R1/EBP50 complex and probably with USH1C.By similarity

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1172. Eukaryota.
ENOG410XPHD. LUCA.
GeneTreeiENSGT00760000119021.
HOGENOMiHOG000280684.
HOVERGENiHBG004326.
InParanoidiQ9R1N3.
KOiK13858.
OMAiETYAFNM.
PhylomeDBiQ9R1N3.

Family and domain databases

Gene3Di3.40.1100.10. 2 hits.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 2 hits.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
SUPFAMiSSF55804. SSF55804. 2 hits.
TIGRFAMsiTIGR00834. ae. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9R1N3-1) [UniParc]FASTAAdd to basket
Also known as: NBCn1-B, NBCn1B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEADGAGEQM RPLLTRGPDE EAVVDLGKTS STVNTKFEKE ELESHRAVYV
60 70 80 90 100
GVHVPFSKES RRRHRHRGHK HHHRRRKDKD SDKEDGRESP SYDTPSQRVQ
110 120 130 140 150
FILGTEDDDE EHIPHDLFTE MDELCYRDGE EYEWKETARW LKFEEDVEDG
160 170 180 190 200
GDRWSKPYVA TLSLHSLFEL RSCILNGTVM LDMRASTLDE IADMVLDNMI
210 220 230 240 250
ASGQLDDSIR ENVREALLKR HHHQNEKRFT SRIPLVRSFA DIGKKHSDPH
260 270 280 290 300
LLERNGEGLS ASRHSLRTGL SASNLSLRGE SPLSLLLSHL LPSSRAGTPA
310 320 330 340 350
GSRCTTPVPT PQNSPPSSPS LSRLTSRSSQ QTQPQAPEVL VSPDRDDIPR
360 370 380 390 400
VVIHPPEEDI EALKGQEQKN EENTDFTPGI LASPQSAPGN LDSSKSGEVK
410 420 430 440 450
GNGSGGSREN STVDFSKVDM NFMRKIPTGA EASNVLVGEV DFLERPIIAF
460 470 480 490 500
VRLAPAVLLS GLTEVPVPTR FLFLLLGPAG KAPQYHEIGR SIATLMTDEI
510 520 530 540 550
FHDVAYKAKD RNDLLSGIDE FLDQVTVLPP GEWDPSIRIE PPKSVPSQEK
560 570 580 590 600
RKIPAFPNGS APVSADPPKE ADHHAGPELQ RTGRLFGGLI LDIKRKAPFF
610 620 630 640 650
LSDFKDALSL QCLASILFLY CACMSPVITF GGLLGEATEG RISAIESLFG
660 670 680 690 700
ASLTGIAYSL FAGQPLTILG STGPVLVFEK ILFKFCRDYH LSYLSLRTSI
710 720 730 740 750
GLWTSFLCIV LVATDASSLV CYITRFTEEA FAALICIIFI YEALEKLFHL
760 770 780 790 800
GEIYAFNMHN NLDALTSYTC VCAEPSNPSN ETVELWERKN VTAASISWAN
810 820 830 840 850
LTVSECKTFH GMFVGSACGP HGPYVPDVLF WCVVLFFTTF FLSSFLKQFK
860 870 880 890 900
TKRYFPTKVR STISDFAVFL TIVIMVAIDY LVGIPSPKLH VPEKFEPTDP
910 920 930 940 950
SRGWIISPLG DNPWWTLLIA AVPALLCTIL IFMDQQITAV IINRKEHKLK
960 970 980 990 1000
KGAGYHLDLL MVAVMLGVCS IMGLPWFVAA TVLSISHVNS LKVESECSAP
1010 1020 1030 1040 1050
GEQPKFLGIR EQRVTGLMIF ILMGLSVFMT SVLKFIPMPV LYGVFLYMGV
1060 1070 1080 1090 1100
SSLKGIQFFD RIKLFGMPAK HQPDLIYLRY VPLWKVHVFT VVQLTCLVLL
1110 1120 1130 1140 1150
WVIKASAAAV VFPMMVLALV FVRKLMDLCF TKRELSWLDD LMPESKKKKE
1160 1170 1180 1190 1200
DDKKKKEKEE AERMLQGDGD TVHLPFERGS LLQIPVKTLK YSPEKPVSVT
1210
INFEDEPSKK YMDAETSL
Length:1,218
Mass (Da):135,954
Last modified:May 1, 2000 - v1
Checksum:iCF5C8BD4F49CAB00
GO
Isoform 2 (identifier: Q9R1N3-2) [UniParc]FASTAAdd to basket
Also known as: NBCn1-D, NBCn1D

The sequence of this isoform differs from the canonical sequence as follows:
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,254
Mass (Da):139,914
Checksum:iF1A3407D82806571
GO
Isoform 3 (identifier: Q9R1N3-3) [UniParc]FASTAAdd to basket
Also known as: NBCn1-C, NBCn1C

The sequence of this isoform differs from the canonical sequence as follows:
     245-257: Missing.
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,241
Mass (Da):138,401
Checksum:i47EB5697EDF23794
GO
Isoform 4 (identifier: Q9R1N3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     256-378: Missing.
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,131
Mass (Da):126,849
Checksum:i017EE50156ADFA01
GO
Isoform 5 (identifier: Q9R1N3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-255: Missing.
     256-378: Missing.
     1192-1192: S → SIDPSVVNISDEMAKTAQWKALSMNTENAKVTRPNMS

Show »
Length:1,120
Mass (Da):125,521
Checksum:i1E56095A4D774548
GO
Isoform 6 (identifier: Q9R1N3-6) [UniParc]FASTAAdd to basket
Also known as: NBCn1-E

The sequence of this isoform differs from the canonical sequence as follows:
     256-378: Missing.

Show »
Length:1,095
Mass (Da):122,888
Checksum:i8D6D1CFE08856115
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017169245 – 257Missing in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_017170245 – 255Missing in isoform 5. CuratedAdd BLAST11
Alternative sequenceiVSP_017171256 – 378Missing in isoform 4, isoform 5 and isoform 6. CuratedAdd BLAST123
Alternative sequenceiVSP_0171721192S → SIDPSVVNISDEMAKTAQWK ALSMNTENAKVTRPNMS in isoform 2, isoform 3, isoform 4 and isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069511 mRNA. Translation: AAF14345.1.
AF070475 mRNA. Translation: AAD46389.1.
AF080106 mRNA. Translation: AAD47142.1.
RefSeqiNP_001257790.1. NM_001270861.1. [Q9R1N3-1]
NP_478118.1. NM_058211.2. [Q9R1N3-2]
UniGeneiRn.26856.

Genome annotation databases

EnsembliENSRNOT00000008759; ENSRNOP00000008759; ENSRNOG00000005957. [Q9R1N3-2]
ENSRNOT00000049771; ENSRNOP00000047758; ENSRNOG00000005957. [Q9R1N3-1]
ENSRNOT00000068171; ENSRNOP00000063542; ENSRNOG00000005957. [Q9R1N3-4]
GeneIDi117955.
KEGGirno:117955.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069511 mRNA. Translation: AAF14345.1.
AF070475 mRNA. Translation: AAD46389.1.
AF080106 mRNA. Translation: AAD47142.1.
RefSeqiNP_001257790.1. NM_001270861.1. [Q9R1N3-1]
NP_478118.1. NM_058211.2. [Q9R1N3-2]
UniGeneiRn.26856.

3D structure databases

ProteinModelPortaliQ9R1N3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi250777. 1 interactor.
STRINGi10116.ENSRNOP00000008759.

Protein family/group databases

TCDBi2.A.31.2.1. the anion exchanger (ae) family.

PTM databases

iPTMnetiQ9R1N3.
PhosphoSitePlusiQ9R1N3.
SwissPalmiQ9R1N3.

Proteomic databases

PaxDbiQ9R1N3.
PRIDEiQ9R1N3.

Protocols and materials databases

DNASUi117955.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000008759; ENSRNOP00000008759; ENSRNOG00000005957. [Q9R1N3-2]
ENSRNOT00000049771; ENSRNOP00000047758; ENSRNOG00000005957. [Q9R1N3-1]
ENSRNOT00000068171; ENSRNOP00000063542; ENSRNOG00000005957. [Q9R1N3-4]
GeneIDi117955.
KEGGirno:117955.

Organism-specific databases

CTDi9497.
RGDi621208. Slc4a7.

Phylogenomic databases

eggNOGiKOG1172. Eukaryota.
ENOG410XPHD. LUCA.
GeneTreeiENSGT00760000119021.
HOGENOMiHOG000280684.
HOVERGENiHBG004326.
InParanoidiQ9R1N3.
KOiK13858.
OMAiETYAFNM.
PhylomeDBiQ9R1N3.

Enzyme and pathway databases

ReactomeiR-RNO-425381. Bicarbonate transporters.

Miscellaneous databases

PROiQ9R1N3.

Gene expression databases

BgeeiENSRNOG00000005957.
ExpressionAtlasiQ9R1N3. baseline and differential.
GenevisibleiQ9R1N3. RN.

Family and domain databases

Gene3Di3.40.1100.10. 2 hits.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 2 hits.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
SUPFAMiSSF55804. SSF55804. 2 hits.
TIGRFAMsiTIGR00834. ae. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiS4A7_RAT
AccessioniPrimary (citable) accession number: Q9R1N3
Secondary accession number(s): Q9QYD5, Q9R1L1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.