Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 7

Gene

Dlc1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Functions as a GTPase-activating protein for the small GTPases RHOA, RHOB, RHOC and CDC42, terminating their downstream signaling. This induces morphological changes and detachment through cytoskeletal reorganization, playing a critical role in biological processes such as cell migration and proliferation. Also functions in vivo as an activator of the phospholipase PLCD1. Active DLC1 increases cell migration velocity but reduces directionality (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • actin cytoskeleton organization Source: MGI
  • activation of cysteine-type endopeptidase activity involved in apoptotic process Source: MGI
  • apoptotic process Source: MGI
  • focal adhesion assembly Source: MGI
  • forebrain development Source: MGI
  • heart morphogenesis Source: MGI
  • hindbrain morphogenesis Source: MGI
  • negative regulation of cell migration Source: MGI
  • negative regulation of cell proliferation Source: UniProtKB
  • negative regulation of focal adhesion assembly Source: MGI
  • negative regulation of Rho protein signal transduction Source: MGI
  • negative regulation of stress fiber assembly Source: MGI
  • neural tube closure Source: MGI
  • positive regulation of execution phase of apoptosis Source: MGI
  • positive regulation of protein dephosphorylation Source: MGI
  • regulation of actin cytoskeleton organization Source: MGI
  • regulation of cell shape Source: MGI
  • signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 7
Alternative name(s):
Deleted in liver cancer 1 protein homolog
Short name:
DLC-1
Rho-type GTPase-activating protein 7
START domain-containing protein 12
Short name:
StARD12
StAR-related lipid transfer protein 12
Gene namesi
Name:Dlc1
Synonyms:Arhgap7, Stard12
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1354949. Dlc1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000567081 – 1092Rho GTPase-activating protein 7Add BLAST1092

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei86PhosphoserineCombined sources1
Modified residuei89PhosphoserineCombined sources1
Modified residuei129PhosphoserineBy similarity1
Modified residuei322PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9R0Z9.
PRIDEiQ9R0Z9.

PTM databases

iPTMnetiQ9R0Z9.
PhosphoSitePlusiQ9R0Z9.

Expressioni

Tissue specificityi

Widely expressed with the highest levels in heart, liver and lung.

Gene expression databases

BgeeiENSMUSG00000031523.
CleanExiMM_DLC1.

Interactioni

Subunit structurei

Interacts with EF1A1, facilitates EF1A1 distribution to the membrane periphery and ruffles upon growth factor stimulation and suppresses cell migration.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi206100. 1 interactor.
IntActiQ9R0Z9. 1 interactor.
STRINGi10090.ENSMUSP00000132812.

Structurei

3D structure databases

ProteinModelPortaliQ9R0Z9.
SMRiQ9R0Z9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 78SAMAdd BLAST68
Domaini642 – 848Rho-GAPPROSITE-ProRule annotationAdd BLAST207
Domaini878 – 1085STARTPROSITE-ProRule annotationAdd BLAST208

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni275 – 448Focal adhesion-targeting (FAT)By similarityAdd BLAST174
Regioni615 – 637Polybasic cluster (PBR)By similarityAdd BLAST23

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi306 – 312Poly-Ser7
Compositional biasi432 – 438Poly-Ser7

Domaini

The SAM domain mediates interaction with EF1A1, and functions as an autoinhibitory regulator of RhoGAP Activity.By similarity
The polybasic cluster is required for activation and mediates binding to phosphatidylinositol-4,5-bisphosphate (PI(4,5)P2) containing membranes.By similarity

Sequence similaritiesi

Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
Contains 1 START domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2200. Eukaryota.
ENOG410XQ10. LUCA.
HOGENOMiHOG000039960.
HOVERGENiHBG055955.
InParanoidiQ9R0Z9.
KOiK20632.
PhylomeDBiQ9R0Z9.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
3.30.530.20. 1 hit.
InterProiIPR028854. DLC1.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view]
PANTHERiPTHR12659:SF2. PTHR12659:SF2. 1 hit.
PfamiPF00620. RhoGAP. 1 hit.
PF07647. SAM_2. 1 hit.
PF01852. START. 1 hit.
[Graphical view]
SMARTiSM00324. RhoGAP. 1 hit.
SM00234. START. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF48350. SSF48350. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
PS50848. START. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9R0Z9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCRDEPDTMI LTQIEAKEAC DWLRVTGFPQ YAQLYEDLLF PVDIALVKRE
60 70 80 90 100
HDFLDRDAIE ALCRRLNTLN KCAVMKLEIS PHRKRSEDSD EDEPCAISGK
110 120 130 140 150
WTFQRDSKRW SRLEEFDVFF PKQDPIPGSP DNSRLQSATS HESMLTDLSE
160 170 180 190 200
HQEVASVRSL SSTSSSVPTH AAHSGDATTP RTNSVISVCS SGHFVGNDDS
210 220 230 240 250
FSSLPSPKEL SSFSFSMKGH HEKNTKSKTR SLLKRMESLK LKGSHHSKHK
260 270 280 290 300
APSKLGLIIS APILQEGMDE AKLKQLNCVE ISALNGNHIN VPMVRKRSVS
310 320 330 340 350
NSTQTSSSSS QSETSSAVST PSPVTRTRSL STCNKRVGMY LEGFDPFSQS
360 370 380 390 400
TLNNVTEQNY KNRESYPEDT VFYIPEDHKP GTFPKALSHG SFCPSGNSSV
410 420 430 440 450
NWRTGSFHGP GHLSLRRENS HDSPKELKRR NSSSSLSSRL SIYDNVPGSI
460 470 480 490 500
LYSSSGELAD LENEDIFPEL DDILYHVKGM QRIVNQWSEK FSDEGDSDSA
510 520 530 540 550
LDSVSPCPSS PKQIHLDVDH DRRTPSDLDS TGNSLNEPEE PTDIPERRDS
560 570 580 590 600
GVGASLTRCN RHRLRWHSFQ SSHRPSLNSV SLQINCQSVA QMNLLQKYSL
610 620 630 640 650
LKLTALLEKY TPSNKHGFSW AVPKFMKRIK VPDYKDRSVF GVPLTVNVQR
660 670 680 690 700
SGQPLPQSIQ QAMRYLRNHC LDQVGLFRKS GVKSRIQALR QMNESAEDNV
710 720 730 740 750
NYEGQSAYDV ADMLKQYFRD LPEPLMTNKL SETFLQIYQY VPKDQRLQAI
760 770 780 790 800
KAAIMLLPDE NREVLQTLLY FLSDVTAAVK ENQMTPTNLA VCLAPSLFHL
810 820 830 840 850
NTLKRENSSP RVMQRKQSLG KPDQKDLNEN LAATQGLAHM IAECKKLFQV
860 870 880 890 900
PEEMSRCRNS YTEQELKPLT LEALGHLNSD QPADYRHFLQ DCVDGLFKEV
910 920 930 940 950
KEKFKGWVSY PTSEQADLSY KKVSEGPPLR LWRSTIEVPA APEEILKRLL
960 970 980 990 1000
KEQHLWDVDL LDSKVIEILD SQTEIYQYVQ NSMAPHPARD YVVLRTWRTN
1010 1020 1030 1040 1050
LPRGACALLL TSVDHDRAPV AGVRVNVLLS RYLIEPCGSG KSKLTYMCRA
1060 1070 1080 1090
DLRGHMPEWY SKSFGHLCAA EVVKIRDSFS NQNTESKDTR SR
Length:1,092
Mass (Da):123,367
Last modified:November 8, 2002 - v2
Checksum:i9B5DC3103986A751
GO
Isoform 2 (identifier: Q9R0Z9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MCRDEPDTMILTQ → MGDPEGHVMARPLRGPLRRSFSDHIRDSTARALDAIWKNTRERRLAE

Note: No experimental confirmation available.
Show »
Length:1,126
Mass (Da):127,257
Checksum:i5FEA7BA290AE36CE
GO

Sequence cautioni

The sequence AAL87620 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti42V → I in BAE36903 (PubMed:16141072).Curated1
Sequence conflicti42V → I in BAE27982 (PubMed:16141072).Curated1
Sequence conflicti120F → S in BAE36903 (PubMed:16141072).Curated1
Sequence conflicti120F → S in BAE27982 (PubMed:16141072).Curated1
Sequence conflicti192G → R in AAD51760 (PubMed:10702663).Curated1
Sequence conflicti421 – 422HD → SH in AAD51760 (PubMed:10702663).Curated2
Sequence conflicti715 – 717KQY → NRN in AAD51760 (PubMed:10702663).Curated3
Sequence conflicti730 – 735LSETFL → FSEPSM in AAD51760 (PubMed:10702663).Curated6
Sequence conflicti917D → E in BAE36903 (PubMed:16141072).Curated1
Sequence conflicti917D → E in BAE27982 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0261441 – 13MCRDE…MILTQ → MGDPEGHVMARPLRGPLRRS FSDHIRDSTARALDAIWKNT RERRLAE in isoform 2. 1 PublicationAdd BLAST13

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF178078 mRNA. Translation: AAD51760.1.
AF411442
, AF411435, AF411436, AF411437, AF411438, AF411439, AF411440, AF411441 Genomic DNA. Translation: AAL87620.1. Different initiation.
AK147539 mRNA. Translation: BAE27982.1.
AK162413 mRNA. Translation: BAE36903.1.
CCDSiCCDS40322.1. [Q9R0Z9-1]
CCDS57616.1. [Q9R0Z9-2]
RefSeqiNP_001181870.1. NM_001194941.1.
NP_056617.2. NM_015802.3.
UniGeneiMm.125155.
Mm.210875.

Genome annotation databases

GeneIDi50768.
KEGGimmu:50768.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF178078 mRNA. Translation: AAD51760.1.
AF411442
, AF411435, AF411436, AF411437, AF411438, AF411439, AF411440, AF411441 Genomic DNA. Translation: AAL87620.1. Different initiation.
AK147539 mRNA. Translation: BAE27982.1.
AK162413 mRNA. Translation: BAE36903.1.
CCDSiCCDS40322.1. [Q9R0Z9-1]
CCDS57616.1. [Q9R0Z9-2]
RefSeqiNP_001181870.1. NM_001194941.1.
NP_056617.2. NM_015802.3.
UniGeneiMm.125155.
Mm.210875.

3D structure databases

ProteinModelPortaliQ9R0Z9.
SMRiQ9R0Z9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206100. 1 interactor.
IntActiQ9R0Z9. 1 interactor.
STRINGi10090.ENSMUSP00000132812.

PTM databases

iPTMnetiQ9R0Z9.
PhosphoSitePlusiQ9R0Z9.

Proteomic databases

PaxDbiQ9R0Z9.
PRIDEiQ9R0Z9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi50768.
KEGGimmu:50768.

Organism-specific databases

CTDi10395.
MGIiMGI:1354949. Dlc1.

Phylogenomic databases

eggNOGiKOG2200. Eukaryota.
ENOG410XQ10. LUCA.
HOGENOMiHOG000039960.
HOVERGENiHBG055955.
InParanoidiQ9R0Z9.
KOiK20632.
PhylomeDBiQ9R0Z9.

Miscellaneous databases

ChiTaRSiDlc1. mouse.
PROiQ9R0Z9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000031523.
CleanExiMM_DLC1.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
3.30.530.20. 1 hit.
InterProiIPR028854. DLC1.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR023393. START-like_dom.
IPR002913. START_lipid-bd_dom.
[Graphical view]
PANTHERiPTHR12659:SF2. PTHR12659:SF2. 1 hit.
PfamiPF00620. RhoGAP. 1 hit.
PF07647. SAM_2. 1 hit.
PF01852. START. 1 hit.
[Graphical view]
SMARTiSM00324. RhoGAP. 1 hit.
SM00234. START. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
SSF48350. SSF48350. 1 hit.
PROSITEiPS50238. RHOGAP. 1 hit.
PS50848. START. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRHG07_MOUSE
AccessioniPrimary (citable) accession number: Q9R0Z9
Secondary accession number(s): Q3TRX3, Q3UH75, Q8R541
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: November 8, 2002
Last modified: November 2, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.