Q9R007 (CLC5A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C-type lectin domain family 5 member A Alternative name(s): C-type lectin superfamily member 5 Myeloid DAP12-associating lectin 1 Short name=MDL-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 190 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a positive regulator of osteoclastogenesis. Cell surface receptor that signals via TYROBP. Regulates inflammatory responses. Acts as a key regulator of synovial injury and bone erosion during autoimmune joint inflammation. Critical macrophage receptor for dengue virus serotypes 1-4. The binding of dengue virus to CLEC5A triggers signaling through phosphylation of TYROBP, this interaction does not result in viral entry but stimulates proinflammatory cytokine release. Ref.1 Ref.5 Ref.7 Ref.8 |
| Subunit structure | Monomer. Homodimer. The majority of CLEC5A is expressed as a monomeric form on macrophages. Interacts with TYROBP/DAP12. The interaction with TYROBP is required for CLEC5 cell surface expression. Interacts with HCST/DAP10. Forms an CLEC5A/TYROBP/HCST trimolecular complex depending almost solely on TYROBP. Ref.1 Ref.6 Ref.7 |
| Subcellular location | |
| Tissue specificity | Expressed in macrophage cell line J-774, but not in T-cell lines, B-cell lines, or mast cell lines. Strong expression in bone marrow cells or thioglycollate induced neutrophils (at protein level). Ref.1 Ref.6 Ref.8 |
| Induction | Up-regulated during the differentiation of myeloid cell line 32Dcl3 into neutrophils. |
| Post-translational modification | |
| Involvement in disease | Involved in the pathogenetic mechanisms of Japanese encephalitis virus (JEV) infection of the brain. JEV infection of young mice results in increased expression of CLEC5A in spleen and brain with consequent activation of proinflammatory cytokines secretion. |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: Q9R007-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9R007-1) The sequence of this isoform differs from the canonical sequence as follows: 28-57: PQVFGKSNDGFVPTESYGTTSVQNVSQIFG → SQIFG | ||||||
| Isoform 2 (identifier: Q9R007-2) The sequence of this isoform differs from the canonical sequence as follows: 118-118: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 190 | 190 | C-type lectin domain family 5 member A | PRO_0000046633 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 4 | 4 | Cytoplasmic Potential | ||||||||
| Transmembrane | 5 – 25 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 26 – 190 | 165 | Extracellular Potential | ||||||||
| Domain | 80 – 186 | 107 | C-type lectin | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 51 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 146 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 153 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 101 ↔ 185 | By similarity | |||||||||
| Disulfide bond | 163 ↔ 177 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 28 – 57 | 30 | PQVFG…SQIFG → SQIFG in isoform 1. | VSP_041577 | |||||||
| Alternative sequence | 118 | 1 | Missing in isoform 2. | VSP_012840 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Myeloid DAP12-associating lectin (MDL)-1 is a cell surface receptor involved in the activation of myeloid cells." Bakker A.B.H., Baker E., Sutherland G.R., Phillips J.H., Lanier L.L. Proc. Natl. Acad. Sci. U.S.A. 96:9792-9796(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH TYROBP. Strain: BALB/c. Tissue: Myeloid. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Adipose tissue and Bone. |
| [3] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [5] | "CLEC5A is critical for dengue-virus-induced lethal disease." Chen S.T., Lin Y.L., Huang M.T., Wu M.F., Cheng S.C., Lei H.Y., Lee C.K., Chiou T.W., Wong C.H., Hsieh S.L. Nature 453:672-676(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION AS A DENGUE VIRUS RECEPTOR. |
| [6] | "Expression and functional role of MDL-1 (CLEC5A) in mouse myeloid lineage cells." Aoki N., Kimura Y., Kimura S., Nagato T., Azumi M., Kobayashi H., Sato K., Tateno M. J. Leukoc. Biol. 85:508-517(2009) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INTERACTION WITH HCST, SUBCELLULAR LOCATION, GLYCOSYLATION, SIALIC ACID CONTENT. |
| [7] | "Signal adaptor DAP10 associates with MDL-1 and triggers osteoclastogenesis in cooperation with DAP12." Inui M., Kikuchi Y., Aoki N., Endo S., Maeda T., Sugahara-Tobinai A., Fujimura S., Nakamura A., Kumanogoh A., Colonna M., Takai T. Proc. Natl. Acad. Sci. U.S.A. 106:4816-4821(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HCST, GLYCOSYLATION, FUNCTION. |
| [8] | "Myeloid DAP12-associating lectin (MDL)-1 regulates synovial inflammation and bone erosion associated with autoimmune arthritis." Joyce-Shaikh B., Bigler M.E., Chao C.C., Murphy E.E., Blumenschein W.M., Adamopoulos I.E., Heyworth P.G., Antonenko S., Bowman E.P., McClanahan T.K., Phillips J.H., Cua D.J. J. Exp. Med. 207:579-589(2010) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, FUNCTION. |
| [9] | "Expression profile of Japanese encephalitis virus induced neuroinflammation and its implication in disease severity." Gupta N., Lomash V., Rao P.V. J. Clin. Virol. 49:4-10(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN JAPANESE ENCEPHALITIS VIRUS INFECTION. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF139769 mRNA. Translation: AAF02492.1. AK036697 mRNA. Translation: BAC29537.1. AK046600 mRNA. Translation: BAC32802.1. AK137482 mRNA. Translation: BAE23374.1. CH466533 Genomic DNA. Translation: EDL13570.1. BC104364 mRNA. Translation: AAI04365.1. BC104365 mRNA. Translation: AAI04366.1. |
| IPI | IPI00126729. IPI00553591. IPI00652111. |
| RefSeq | NP_001033693.1. NM_001038604.1. NP_067339.1. NM_021364.2. |
| UniGene | Mm.103765. |
3D structure databases | |
| ProteinModelPortal | Q9R007. |
| SMR | Q9R007. Positions 72-189. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-48775N. |
Proteomic databases | |
| PRIDE | Q9R007. |
Protocols and materials databases | |
| DNASU | 23845. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000101491; ENSMUSP00000099030; ENSMUSG00000029915. ENSMUST00000129948; ENSMUSP00000121848; ENSMUSG00000029915. ENSMUST00000177178; ENSMUSP00000135240; ENSMUSG00000029915. |
| GeneID | 23845. |
| KEGG | mmu:23845. |
| UCSC | uc009bna.1. mouse. uc009bnb.1. mouse. uc009bnc.1. mouse. |
Organism-specific databases | |
| CTD | 23601. |
| MGI | MGI:1345151. Clec5a. |
Phylogenomic databases | |
| eggNOG | NOG269413. |
| GeneTree | ENSGT00680000099819. |
| HOGENOM | HOG000252978. |
| HOVERGEN | HBG081250. |
| InParanoid | Q3SXC9. |
| KO | K10073. |
| OMA | KWRWINN. |
| OrthoDB | EOG473PSF. |
Gene expression databases | |
| Bgee | Q9R007. |
| CleanEx | MM_CLEC5A. |
| Genevestigator | Q9R007. |
| GermOnline | ENSMUSG00000029915. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.10.100.10. 1 hit. |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. [Graphical view] |
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 303527. |
| SOURCE | Search... |
Entry information
| Entry name | CLC5A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9R007 Secondary accession number(s): Q3SXC9, Q3UV97, Q8BL24 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
