Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier organic anion transporter family member 1B2

Gene

Slco1b2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates the Na+-independent uptake of organic anions such as taurochlate, bromosulfophthalein and steroid conjugates such as estrone-3-sulfate, 17-beta-glucuronosyl estradiol, dehydroepiandrosterone sulfate and prostaglandin E2.

GO - Molecular functioni

  • bile acid transmembrane transporter activity Source: RGD
  • drug transmembrane transporter activity Source: RGD
  • oligopeptide transporter activity Source: RGD
  • organic anion transmembrane transporter activity Source: RGD

GO - Biological processi

  • bile acid and bile salt transport Source: RGD
  • drug transmembrane transport Source: GOC
  • drug transport Source: RGD
  • liver development Source: RGD
  • oligopeptide transport Source: RGD
  • response to antibiotic Source: RGD
  • response to cytokine Source: RGD
  • response to drug Source: RGD
  • response to glucocorticoid Source: RGD
  • response to lipid Source: RGD
  • response to lipopolysaccharide Source: RGD
  • response to peptide hormone Source: RGD
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-RNO-159418. Recycling of bile acids and salts.
R-RNO-879518. Transport of organic anions.

Protein family/group databases

TCDBi2.A.60.1.8. the organo anion transporter (oat) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier organic anion transporter family member 1B2
Alternative name(s):
Liver-specific organic anion transporter 1
Short name:
rLST-1
Sodium-independent organic anion-transporting polypeptide 4
Short name:
OATP-4
Solute carrier family 21 member 10
Gene namesi
Name:Slco1b2
Synonyms:Oatp1b2, Slc21a10
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi69300. Slco1b2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2828CytoplasmicSequence analysisAdd
BLAST
Transmembranei29 – 4820HelicalSequence analysisAdd
BLAST
Topological domaini49 – 6719ExtracellularSequence analysisAdd
BLAST
Transmembranei68 – 8821HelicalSequence analysisAdd
BLAST
Topological domaini89 – 946CytoplasmicSequence analysis
Transmembranei95 – 11925HelicalSequence analysisAdd
BLAST
Topological domaini120 – 16546ExtracellularSequence analysisAdd
BLAST
Transmembranei166 – 19429HelicalSequence analysisAdd
BLAST
Topological domaini195 – 21319CytoplasmicSequence analysisAdd
BLAST
Transmembranei214 – 23421HelicalSequence analysisAdd
BLAST
Topological domaini235 – 25218ExtracellularSequence analysisAdd
BLAST
Transmembranei253 – 27725HelicalSequence analysisAdd
BLAST
Topological domaini278 – 32851CytoplasmicSequence analysisAdd
BLAST
Transmembranei329 – 35022HelicalSequence analysisAdd
BLAST
Topological domaini351 – 37020ExtracellularSequence analysisAdd
BLAST
Transmembranei371 – 39424HelicalSequence analysisAdd
BLAST
Topological domaini395 – 3984CytoplasmicSequence analysis
Transmembranei399 – 42224HelicalSequence analysisAdd
BLAST
Topological domaini423 – 531109ExtracellularSequence analysisAdd
BLAST
Transmembranei532 – 55423HelicalSequence analysisAdd
BLAST
Topological domaini555 – 5639CytoplasmicSequence analysis
Transmembranei564 – 58926HelicalSequence analysisAdd
BLAST
Topological domaini590 – 62334ExtracellularSequence analysisAdd
BLAST
Transmembranei624 – 64118HelicalSequence analysisAdd
BLAST
Topological domaini642 – 68746CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • basolateral plasma membrane Source: RGD
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL1781861.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 687687Solute carrier organic anion transporter family member 1B2PRO_0000191052Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi134 – 1341N-linked (GlcNAc...)Sequence analysis
Modified residuei290 – 2901PhosphoserineCombined sources
Modified residuei292 – 2921PhosphoserineBy similarity
Disulfide bondi456 ↔ 482PROSITE-ProRule annotation
Disulfide bondi460 ↔ 471PROSITE-ProRule annotation
Disulfide bondi462 ↔ 486PROSITE-ProRule annotation
Glycosylationi496 – 4961N-linked (GlcNAc...)Sequence analysis
Glycosylationi511 – 5111N-linked (GlcNAc...)Sequence analysis
Modified residuei660 – 6601PhosphothreonineBy similarity
Modified residuei667 – 6671PhosphoserineCombined sources

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9QZX8.
PRIDEiQ9QZX8.

PTM databases

iPTMnetiQ9QZX8.
PhosphoSiteiQ9QZX8.

Expressioni

Tissue specificityi

Liver specific. Expression is highest in central perivenous hepatocytes and lowest in the periportal region. Isoform 1 predominates. Not detected in heart, brain, kidney, skeletal muscle, lung, testis or spleen.

Gene expression databases

GenevisibleiQ9QZX8. RN.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000013409.

Structurei

3D structure databases

ProteinModelPortaliQ9QZX8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini450 – 50758Kazal-likePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 Kazal-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3626. Eukaryota.
ENOG410XRSF. LUCA.
GeneTreeiENSGT00760000119014.
HOVERGENiHBG063896.
InParanoidiQ9QZX8.
KOiK05043.
OMAiTLHTIAM.
OrthoDBiEOG7GFB4C.
PhylomeDBiQ9QZX8.
TreeFamiTF317540.

Family and domain databases

InterProiIPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR004156. OA_transporter.
[Graphical view]
PANTHERiPTHR11388. PTHR11388. 1 hit.
PfamiPF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.
TIGRFAMsiTIGR00805. oat. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QZX8-2) [UniParc]FASTAAdd to basket

Also known as: rLST-1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDHTQQSRKA AEAQPSRSKQ TRFCDGFKLF LAALSFSYIC KALGGVVMKS
60 70 80 90 100
SITQIERRFD IPSSISGLID GGFEIGNLLV IVFVSYFGSK LHRPKLIGIG
110 120 130 140 150
CFIMGIGSIL TALPHFFMGY YKYAKENDIG SLGNSTLTCF INQMTSPTGP
160 170 180 190 200
SPEIVEKGCE KGLKSHMWIY VLMGNMLRGI GETPIVPLGI SYLDDFAKEG
210 220 230 240 250
HTSMHLGTLH TIAMIGPILG FIMSSVFAKI YVDVGYVDLN SVRITPNDAR
260 270 280 290 300
WVGAWWLSFI VNGLLCITSS IPFFFLPKIP KRSQEERKNS VSLHAPKTDE
310 320 330 340 350
EKKHMTNLTK QEEQDPSNMT GFLRSLRSIL TNEIYVIFLI LTLLQVSGFI
360 370 380 390 400
GSFTYLFKFI EQQFGRTASQ ANFLLGIITI PTMATAMFLG GYIVKKFKLT
410 420 430 440 450
SVGIAKFVFF TSSVAYAFQF LYFPLLCENK PFAGLTLTYD GMNPVDSHID
460 470 480 490 500
VPLSYCNSDC SCDKNQWEPI CGENGVTYIS PCLAGCKSFR GDKKPNNTEF
510 520 530 540 550
YDCSCISNSG NNSAHLGECP RYKCKTNYYF YIILQVTVSF FTAMGSPSLI
560 570 580 590 600
LILMKSVQPE LKSLAMGFHS LIIRALGGIL APIYYGAFID RTCIKWSVTS
610 620 630 640 650
CGKRGACRLY NSRLFGFSYL GLNLALKTPP LFLYVVLIYF TKRKYKRNDN
660 670 680
KTLENGRQFT DEGNPDSVNK NGYYCVPYDE QSNETPL
Length:687
Mass (Da):76,767
Last modified:January 11, 2011 - v2
Checksum:iE6A17786FD136CC6
GO
Isoform 2 (identifier: Q9QZX8-1) [UniParc]FASTAAdd to basket

Also known as: rLST-1b

The sequence of this isoform differs from the canonical sequence as follows:
     407-441: Missing.

Show »
Length:652
Mass (Da):72,767
Checksum:i8100FD4248893F70
GO
Isoform 3 (identifier: Q9QZX8-3) [UniParc]FASTAAdd to basket

Also known as: rLST-1c

The sequence of this isoform differs from the canonical sequence as follows:
     207-240: GTLHTIAMIGPILGFIMSSVFAKIYVDVGYVDLN → D

Show »
Length:654
Mass (Da):73,244
Checksum:iE3A31785AE9C76E0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei207 – 24034GTLHT…YVDLN → D in isoform 3. 1 PublicationVSP_006151Add
BLAST
Alternative sequencei407 – 44135Missing in isoform 2. 1 PublicationVSP_006150Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF147740 mRNA. Translation: AAF02526.1.
AF208545 mRNA. Translation: AAF87098.1.
AF217450 mRNA. Translation: AAF87099.1.
AF272571
, AF272558, AF272559, AF272560, AF272561, AF272562, AF272563, AF272564, AF272565, AF272566, AF272567, AF272568, AF272569, AF272570 Genomic DNA. Translation: AAF90136.1.
AJ271682 mRNA. Translation: CAB92299.1.
RefSeqiNP_001257515.1. NM_001270586.1. [Q9QZX8-1]
NP_001257516.1. NM_001270587.1. [Q9QZX8-3]
NP_113838.1. NM_031650.3. [Q9QZX8-2]
UniGeneiRn.48740.

Genome annotation databases

EnsembliENSRNOT00000013409; ENSRNOP00000013409; ENSRNOG00000030538. [Q9QZX8-2]
ENSRNOT00000013514; ENSRNOP00000013514; ENSRNOG00000030538. [Q9QZX8-3]
GeneIDi58978.
KEGGirno:58978.
UCSCiRGD:69300. rat. [Q9QZX8-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF147740 mRNA. Translation: AAF02526.1.
AF208545 mRNA. Translation: AAF87098.1.
AF217450 mRNA. Translation: AAF87099.1.
AF272571
, AF272558, AF272559, AF272560, AF272561, AF272562, AF272563, AF272564, AF272565, AF272566, AF272567, AF272568, AF272569, AF272570 Genomic DNA. Translation: AAF90136.1.
AJ271682 mRNA. Translation: CAB92299.1.
RefSeqiNP_001257515.1. NM_001270586.1. [Q9QZX8-1]
NP_001257516.1. NM_001270587.1. [Q9QZX8-3]
NP_113838.1. NM_031650.3. [Q9QZX8-2]
UniGeneiRn.48740.

3D structure databases

ProteinModelPortaliQ9QZX8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000013409.

Chemistry

ChEMBLiCHEMBL1781861.

Protein family/group databases

TCDBi2.A.60.1.8. the organo anion transporter (oat) family.

PTM databases

iPTMnetiQ9QZX8.
PhosphoSiteiQ9QZX8.

Proteomic databases

PaxDbiQ9QZX8.
PRIDEiQ9QZX8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000013409; ENSRNOP00000013409; ENSRNOG00000030538. [Q9QZX8-2]
ENSRNOT00000013514; ENSRNOP00000013514; ENSRNOG00000030538. [Q9QZX8-3]
GeneIDi58978.
KEGGirno:58978.
UCSCiRGD:69300. rat. [Q9QZX8-2]

Organism-specific databases

CTDi28253.
RGDi69300. Slco1b2.

Phylogenomic databases

eggNOGiKOG3626. Eukaryota.
ENOG410XRSF. LUCA.
GeneTreeiENSGT00760000119014.
HOVERGENiHBG063896.
InParanoidiQ9QZX8.
KOiK05043.
OMAiTLHTIAM.
OrthoDBiEOG7GFB4C.
PhylomeDBiQ9QZX8.
TreeFamiTF317540.

Enzyme and pathway databases

ReactomeiR-RNO-159418. Recycling of bile acids and salts.
R-RNO-879518. Transport of organic anions.

Miscellaneous databases

PROiQ9QZX8.

Gene expression databases

GenevisibleiQ9QZX8. RN.

Family and domain databases

InterProiIPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR004156. OA_transporter.
[Graphical view]
PANTHERiPTHR11388. PTHR11388. 1 hit.
PfamiPF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.
TIGRFAMsiTIGR00805. oat. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization and functional regulation of a novel rat liver-specific organic anion transporter rlst-1."
    Kakyo M., Unno M., Tokui T., Nakagomi R., Nishio T., Iwasashi H., Nakai D., Seki M., Suzuki M., Naitoh T., Matsuno S., Yawo H., Abe T.
    Gastroenterology 117:770-775(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Liver.
  2. "Cloning of the full-length coding sequence of rat liver-specific organic anion transporter-1 (rlst-1) and a splice variant and partial characterization of the rat lst-1 gene."
    Choudhuri S., Ogura K., Klaassen C.D.
    Biochem. Biophys. Res. Commun. 274:79-86(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 3).
    Strain: Sprague-Dawley.
    Tissue: Liver.
  3. "Identification of organic anion transporting polypeptide 4 (Oatp4) as a major full-length isoform of the liver-specific transporter-1 (rlst-1) in rat liver."
    Cattori V., Hagenbuch B., Hagenbuch N., Stieger B., Ha R., Winterhalter K.H., Meier P.J.
    FEBS Lett. 474:242-245(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Sprague-Dawley.
    Tissue: Liver.
  4. "Localization of organic anion transporting polypeptide 4 (Oatp4) in rat liver and comparison of its substrate specificity with Oatp1, Oatp2 and Oatp3."
    Cattori V., van Montfoort J.E., Stieger B., Landmann L., Meijer D.K., Winterhalter K.H., Meier P.J., Hagenbuch B.
    Pflugers Arch. 443:188-195(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION.
  5. "Phosphoproteomic analysis of rat liver by high capacity IMAC and LC-MS/MS."
    Moser K., White F.M.
    J. Proteome Res. 5:98-104(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-290 AND SER-667, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSO1B2_RAT
AccessioniPrimary (citable) accession number: Q9QZX8
Secondary accession number(s): Q9JHF6, Q9JIM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: January 11, 2011
Last modified: June 8, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.