Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Group IIF secretory phospholipase A2

Gene

Pla2g2f

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Hydrolyzes phosphatidylglycerol with a stronger preference as compared to phosphatidylcholine.1 Publication

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.PROSITE-ProRule annotation

Cofactori

Ca2+Note: Binds 1 Ca2+ ion per subunit.

pH dependencei

Optimum pH is 6.0-7.0.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi47 – 471Calcium; via carbonyl oxygenBy similarity
Metal bindingi49 – 491Calcium; via carbonyl oxygenBy similarity
Metal bindingi51 – 511Calcium; via carbonyl oxygenBy similarity
Active sitei67 – 671PROSITE-ProRule annotation
Metal bindingi68 – 681CalciumBy similarity
Active sitei114 – 1141PROSITE-ProRule annotation

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • phospholipase A2 activity Source: MGI

GO - Biological processi

  • lipid catabolic process Source: UniProtKB-KW
  • negative regulation of T cell proliferation Source: MGI
  • phospholipid metabolic process Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-MMU-1482788. Acyl chain remodelling of PC.
R-MMU-1482801. Acyl chain remodelling of PS.
R-MMU-1482839. Acyl chain remodelling of PE.
R-MMU-1482922. Acyl chain remodelling of PI.
R-MMU-1482925. Acyl chain remodelling of PG.
R-MMU-1483166. Synthesis of PA.

Names & Taxonomyi

Protein namesi
Recommended name:
Group IIF secretory phospholipase A2 (EC:3.1.1.4)
Short name:
GIIF sPLA2
Short name:
sPLA2-IIF
Alternative name(s):
Phosphatidylcholine 2-acylhydrolase 2F
Gene namesi
Name:Pla2g2f
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1349661. Pla2g2f.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL5361.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence analysisAdd
BLAST
Chaini21 – 168148Group IIF secretory phospholipase A2PRO_0000022760Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi46 ↔ 138By similarity
Disulfide bondi48 ↔ 64By similarity
Disulfide bondi63 ↔ 120By similarity
Disulfide bondi69 ↔ 145By similarity
Disulfide bondi70 ↔ 113By similarity
Disulfide bondi79 ↔ 106By similarity
Glycosylationi92 – 921N-linked (GlcNAc...)Sequence analysis
Disulfide bondi98 ↔ 111By similarity
Glycosylationi102 – 1021N-linked (GlcNAc...)Sequence analysis
Glycosylationi144 – 1441N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9QZT4.
PRIDEiQ9QZT4.

PTM databases

PhosphoSiteiQ9QZT4.

Expressioni

Tissue specificityi

Strongly expressed in testis.1 Publication

Developmental stagei

Strongly expressed during embryogenesis.1 Publication

Gene expression databases

BgeeiQ9QZT4.
CleanExiMM_PLA2G2F.
GenevisibleiQ9QZT4. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000030526.

Chemistry

BindingDBiQ9QZT4.

Structurei

3D structure databases

ProteinModelPortaliQ9QZT4.
SMRiQ9QZT4. Positions 39-139.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the phospholipase A2 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG4087. Eukaryota.
ENOG411283D. LUCA.
GeneTreeiENSGT00760000119160.
HOGENOMiHOG000231749.
HOVERGENiHBG008137.
InParanoidiQ9QZT4.
KOiK01047.
OMAiLNETECD.
OrthoDBiEOG7N63PF.
PhylomeDBiQ9QZT4.
TreeFamiTF319283.

Family and domain databases

Gene3Di1.20.90.10. 1 hit.
InterProiIPR001211. PLipase_A2.
IPR016090. PLipase_A2_dom.
IPR033113. PLipase_A2_His_AS.
[Graphical view]
PANTHERiPTHR11716. PTHR11716. 1 hit.
PfamiPF00068. Phospholip_A2_1. 1 hit.
[Graphical view]
PRINTSiPR00389. PHPHLIPASEA2.
SMARTiSM00085. PA2c. 1 hit.
[Graphical view]
SUPFAMiSSF48619. SSF48619. 1 hit.
PROSITEiPS00118. PA2_HIS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QZT4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKFFAIAVL AGSVVTTAHS SLLNLKSMVE AITHRNSILS FVGYGCYCGL
60 70 80 90 100
GGRGHPMDEV DWCCHAHDCC YEKLFEQGCR PYVDHYDHRI ENGTMIVCTE
110 120 130 140 150
LNETECDKQT CECDKSLTLC LKDHPYRNKY RGYFNVYCQG PTPNCSIYDP
160
YPEEVTCGHG LPATPVST
Length:168
Mass (Da):18,880
Last modified:May 1, 2000 - v1
Checksum:i9E15FB6AC0F5450C
GO
Isoform 2 (identifier: Q9QZT4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MADGAQANPKGFRKKALVKHSTGRKSPSLRASPSKTSRSSLGM

Show »
Length:210
Mass (Da):23,259
Checksum:i5AC55CD96F68FC28
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MADGAQANPKGFRKKALVKH STGRKSPSLRASPSKTSRSS LGM in isoform 2. 2 PublicationsVSP_037525

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF166099 mRNA. Translation: AAF04500.2.
AK029254 mRNA. Translation: BAC26357.1.
AL844178 Genomic DNA. Translation: CAM21862.1.
BC125567 mRNA. Translation: AAI25568.1.
CCDSiCCDS18832.1. [Q9QZT4-2]
RefSeqiNP_036175.2. NM_012045.4. [Q9QZT4-2]
UniGeneiMm.331989.

Genome annotation databases

EnsembliENSMUST00000030526; ENSMUSP00000030526; ENSMUSG00000028749. [Q9QZT4-2]
GeneIDi26971.
KEGGimmu:26971.
UCSCiuc008vlf.2. mouse. [Q9QZT4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF166099 mRNA. Translation: AAF04500.2.
AK029254 mRNA. Translation: BAC26357.1.
AL844178 Genomic DNA. Translation: CAM21862.1.
BC125567 mRNA. Translation: AAI25568.1.
CCDSiCCDS18832.1. [Q9QZT4-2]
RefSeqiNP_036175.2. NM_012045.4. [Q9QZT4-2]
UniGeneiMm.331989.

3D structure databases

ProteinModelPortaliQ9QZT4.
SMRiQ9QZT4. Positions 39-139.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000030526.

Chemistry

BindingDBiQ9QZT4.
ChEMBLiCHEMBL5361.

PTM databases

PhosphoSiteiQ9QZT4.

Proteomic databases

PaxDbiQ9QZT4.
PRIDEiQ9QZT4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030526; ENSMUSP00000030526; ENSMUSG00000028749. [Q9QZT4-2]
GeneIDi26971.
KEGGimmu:26971.
UCSCiuc008vlf.2. mouse. [Q9QZT4-2]

Organism-specific databases

CTDi64600.
MGIiMGI:1349661. Pla2g2f.

Phylogenomic databases

eggNOGiKOG4087. Eukaryota.
ENOG411283D. LUCA.
GeneTreeiENSGT00760000119160.
HOGENOMiHOG000231749.
HOVERGENiHBG008137.
InParanoidiQ9QZT4.
KOiK01047.
OMAiLNETECD.
OrthoDBiEOG7N63PF.
PhylomeDBiQ9QZT4.
TreeFamiTF319283.

Enzyme and pathway databases

ReactomeiR-MMU-1482788. Acyl chain remodelling of PC.
R-MMU-1482801. Acyl chain remodelling of PS.
R-MMU-1482839. Acyl chain remodelling of PE.
R-MMU-1482922. Acyl chain remodelling of PI.
R-MMU-1482925. Acyl chain remodelling of PG.
R-MMU-1483166. Synthesis of PA.

Miscellaneous databases

NextBioi304915.
PROiQ9QZT4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9QZT4.
CleanExiMM_PLA2G2F.
GenevisibleiQ9QZT4. MM.

Family and domain databases

Gene3Di1.20.90.10. 1 hit.
InterProiIPR001211. PLipase_A2.
IPR016090. PLipase_A2_dom.
IPR033113. PLipase_A2_His_AS.
[Graphical view]
PANTHERiPTHR11716. PTHR11716. 1 hit.
PfamiPF00068. Phospholip_A2_1. 1 hit.
[Graphical view]
PRINTSiPR00389. PHPHLIPASEA2.
SMARTiSM00085. PA2c. 1 hit.
[Graphical view]
SUPFAMiSSF48619. SSF48619. 1 hit.
PROSITEiPS00118. PA2_HIS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "On the diversity of secreted phospholipases A2. Cloning, tissue distribution, and functional expression of two novel mouse group II enzymes."
    Valentin E., Ghomashchi F., Gelb M.H., Lazdunski M., Lambeau G.
    J. Biol. Chem. 274:31195-31202(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, BIOPHYSICOCHEMICAL PROPERTIES.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Head.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.

Entry informationi

Entry nameiPA2GF_MOUSE
AccessioniPrimary (citable) accession number: Q9QZT4
Secondary accession number(s): Q8CE14
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: May 1, 2000
Last modified: March 16, 2016
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.