Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology domain-containing family B member 2

Gene

Plekhb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Involved in retrograde transport of recycling endosomes.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei20 – 201PhosphatidylserineBy similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family B member 2
Short name:
PH domain-containing family B member 2
Alternative name(s):
Evectin-2
Gene namesi
Name:Plekhb2
Synonyms:Evt2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:2385825. Plekhb2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 221221Pleckstrin homology domain-containing family B member 2PRO_0000053890Add
BLAST

Proteomic databases

MaxQBiQ9QZC7.
PaxDbiQ9QZC7.
PRIDEiQ9QZC7.

PTM databases

iPTMnetiQ9QZC7.
PhosphoSiteiQ9QZC7.

Expressioni

Tissue specificityi

Highly expressed in brain, retina, heart and kidney. Detected at lower levels in lung, muscle and nerve.1 Publication

Developmental stagei

Highly expressed at birth and up to day 3; expressed at lower levels in embryo and adult.

Gene expression databases

BgeeiQ9QZC7.
ExpressionAtlasiQ9QZC7. baseline and differential.
GenevisibleiQ9QZC7. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027297.

Structurei

Secondary structure

1
221
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi6 – 127Combined sources
Turni14 – 163Combined sources
Beta strandi18 – 269Combined sources
Beta strandi32 – 376Combined sources
Beta strandi45 – 473Combined sources
Turni49 – 524Combined sources
Beta strandi53 – 575Combined sources
Helixi59 – 613Combined sources
Beta strandi76 – 849Combined sources
Beta strandi86 – 905Combined sources
Helixi94 – 10714Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DHINMR-A3-109[»]
ProteinModelPortaliQ9QZC7.
SMRiQ9QZC7. Positions 2-110.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9QZC7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2 – 109108PHPROSITE-ProRule annotationAdd
BLAST

Domaini

The PH domain specifically binds phosphatidylserine, which is enriched in recycling endosome membranes, it doesn't recognize PIPs.By similarity

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IFNJ. Eukaryota.
ENOG4111G6I. LUCA.
GeneTreeiENSGT00390000013989.
HOGENOMiHOG000253945.
HOVERGENiHBG060487.
InParanoidiQ9QZC7.
OMAiCINIRMG.
OrthoDBiEOG7CZK73.
PhylomeDBiQ9QZC7.
TreeFamiTF331787.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QZC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFVKSGWLL RQSTILKRWK KNWFDLWSDG HLIYYDDQTR QSIEDKVHMP
60 70 80 90 100
VDCINIRTGH ECRDIQPPDG KPRDCLLQIV CRDGKTISLC AESTDDCLAW
110 120 130 140 150
KFTLQDSRTN TAYVGSAILS EETAVAASPP PYAAYATPTP EVYGYGPYSG
160 170 180 190 200
AYPAGTQVVY AANGQAYAVP YQYPYAGVYG QQPANQVIIR ERYRDNDSDL
210 220
ALGMLAGAAT GMALGSLFWV F
Length:221
Mass (Da):24,574
Last modified:May 1, 2000 - v1
Checksum:i36B1E3CA014E1C66
GO
Isoform 2 (identifier: Q9QZC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-221: RDNDSDLALGMLAGAATGMALGSLFWVF → QDYGVRTL

Note: No experimental confirmation available.
Show »
Length:201
Mass (Da):22,624
Checksum:i714670A8A748B318
GO
Isoform 3 (identifier: Q9QZC7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-221: VYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF → NARWLPLPVSAYSGARRRRPPFQLEVK

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):22,923
Checksum:iF0522EF9C64DC397
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti81 – 811C → W in BAC30448 (PubMed:16141072).Curated
Sequence conflicti136 – 1361A → G in BAC38413 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei178 – 22144VYGQQ…LFWVF → NARWLPLPVSAYSGARRRRP PFQLEVK in isoform 3. 1 PublicationVSP_009785Add
BLAST
Alternative sequencei194 – 22128RDNDS…LFWVF → QDYGVRTL in isoform 2. 1 PublicationVSP_009786Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF189817 mRNA. Translation: AAF01332.1.
AK039771 mRNA. Translation: BAC30448.1.
AK082118 mRNA. Translation: BAC38413.1.
AK149868 mRNA. Translation: BAE29136.1.
AK150074 mRNA. Translation: BAE29285.1.
AK166091 mRNA. Translation: BAE38565.1.
BC057994 mRNA. Translation: AAH57994.1.
CCDSiCCDS14874.1. [Q9QZC7-1]
CCDS78558.1. [Q9QZC7-3]
RefSeqiNP_663491.1. NM_145516.2. [Q9QZC7-1]
XP_006495961.1. XM_006495898.2. [Q9QZC7-1]
XP_011236781.1. XM_011238479.1. [Q9QZC7-1]
UniGeneiMm.292751.

Genome annotation databases

EnsembliENSMUST00000027297; ENSMUSP00000027297; ENSMUSG00000026123. [Q9QZC7-1]
ENSMUST00000156687; ENSMUSP00000140475; ENSMUSG00000026123. [Q9QZC7-3]
GeneIDi226971.
KEGGimmu:226971.
UCSCiuc007apl.1. mouse. [Q9QZC7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF189817 mRNA. Translation: AAF01332.1.
AK039771 mRNA. Translation: BAC30448.1.
AK082118 mRNA. Translation: BAC38413.1.
AK149868 mRNA. Translation: BAE29136.1.
AK150074 mRNA. Translation: BAE29285.1.
AK166091 mRNA. Translation: BAE38565.1.
BC057994 mRNA. Translation: AAH57994.1.
CCDSiCCDS14874.1. [Q9QZC7-1]
CCDS78558.1. [Q9QZC7-3]
RefSeqiNP_663491.1. NM_145516.2. [Q9QZC7-1]
XP_006495961.1. XM_006495898.2. [Q9QZC7-1]
XP_011236781.1. XM_011238479.1. [Q9QZC7-1]
UniGeneiMm.292751.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DHINMR-A3-109[»]
ProteinModelPortaliQ9QZC7.
SMRiQ9QZC7. Positions 2-110.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027297.

PTM databases

iPTMnetiQ9QZC7.
PhosphoSiteiQ9QZC7.

Proteomic databases

MaxQBiQ9QZC7.
PaxDbiQ9QZC7.
PRIDEiQ9QZC7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027297; ENSMUSP00000027297; ENSMUSG00000026123. [Q9QZC7-1]
ENSMUST00000156687; ENSMUSP00000140475; ENSMUSG00000026123. [Q9QZC7-3]
GeneIDi226971.
KEGGimmu:226971.
UCSCiuc007apl.1. mouse. [Q9QZC7-1]

Organism-specific databases

CTDi55041.
MGIiMGI:2385825. Plekhb2.

Phylogenomic databases

eggNOGiENOG410IFNJ. Eukaryota.
ENOG4111G6I. LUCA.
GeneTreeiENSGT00390000013989.
HOGENOMiHOG000253945.
HOVERGENiHBG060487.
InParanoidiQ9QZC7.
OMAiCINIRMG.
OrthoDBiEOG7CZK73.
PhylomeDBiQ9QZC7.
TreeFamiTF331787.

Miscellaneous databases

ChiTaRSiPlekhb2. mouse.
EvolutionaryTraceiQ9QZC7.
PROiQ9QZC7.
SOURCEiSearch...

Gene expression databases

BgeeiQ9QZC7.
ExpressionAtlasiQ9QZC7. baseline and differential.
GenevisibleiQ9QZC7. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Evectins: vesicular proteins that carry a pleckstrin homology domain and localize to post-Golgi membranes."
    Krappa R., Nguyen A., Burrola P., Deretic D., Lemke G.
    Proc. Natl. Acad. Sci. U.S.A. 96:4633-4638(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6J.
    Tissue: Bone marrow, Cerebellum, Lung and Spinal cord.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: FVB/N.
    Tissue: Mammary gland.
  4. "Solution structure of the PH domain of evectin-2 from mouse."
    RIKEN structural genomics initiative (RSGI)
    Submitted (SEP-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 3-110.

Entry informationi

Entry nameiPKHB2_MOUSE
AccessioniPrimary (citable) accession number: Q9QZC7
Secondary accession number(s): Q3UDH6, Q8C4I4, Q8CA27
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: May 1, 2000
Last modified: June 8, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.