Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology domain-containing family B member 2

Gene

Plekhb2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Involved in retrograde transport of recycling endosomes.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei20PhosphatidylserineBy similarity1

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family B member 2
Short name:
PH domain-containing family B member 2
Alternative name(s):
Evectin-2
Gene namesi
Name:Plekhb2
Synonyms:Evt2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:2385825. Plekhb2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538901 – 221Pleckstrin homology domain-containing family B member 2Add BLAST221

Proteomic databases

PaxDbiQ9QZC7.
PRIDEiQ9QZC7.

PTM databases

iPTMnetiQ9QZC7.
PhosphoSitePlusiQ9QZC7.

Expressioni

Tissue specificityi

Highly expressed in brain, retina, heart and kidney. Detected at lower levels in lung, muscle and nerve.1 Publication

Developmental stagei

Highly expressed at birth and up to day 3; expressed at lower levels in embryo and adult.

Gene expression databases

BgeeiENSMUSG00000026123.
ExpressionAtlasiQ9QZC7. baseline and differential.
GenevisibleiQ9QZC7. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027297.

Structurei

Secondary structure

1221
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi6 – 12Combined sources7
Turni14 – 16Combined sources3
Beta strandi18 – 26Combined sources9
Beta strandi32 – 37Combined sources6
Beta strandi45 – 47Combined sources3
Turni49 – 52Combined sources4
Beta strandi53 – 57Combined sources5
Helixi59 – 61Combined sources3
Beta strandi76 – 84Combined sources9
Beta strandi86 – 90Combined sources5
Helixi94 – 107Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DHINMR-A3-109[»]
ProteinModelPortaliQ9QZC7.
SMRiQ9QZC7.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9QZC7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini2 – 109PHPROSITE-ProRule annotationAdd BLAST108

Domaini

The PH domain specifically binds phosphatidylserine, which is enriched in recycling endosome membranes, it doesn't recognize PIPs.By similarity

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IFNJ. Eukaryota.
ENOG4111G6I. LUCA.
GeneTreeiENSGT00390000013989.
HOGENOMiHOG000253945.
HOVERGENiHBG060487.
InParanoidiQ9QZC7.
OMAiCINIRMG.
OrthoDBiEOG091G14FB.
PhylomeDBiQ9QZC7.
TreeFamiTF331787.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QZC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAFVKSGWLL RQSTILKRWK KNWFDLWSDG HLIYYDDQTR QSIEDKVHMP
60 70 80 90 100
VDCINIRTGH ECRDIQPPDG KPRDCLLQIV CRDGKTISLC AESTDDCLAW
110 120 130 140 150
KFTLQDSRTN TAYVGSAILS EETAVAASPP PYAAYATPTP EVYGYGPYSG
160 170 180 190 200
AYPAGTQVVY AANGQAYAVP YQYPYAGVYG QQPANQVIIR ERYRDNDSDL
210 220
ALGMLAGAAT GMALGSLFWV F
Length:221
Mass (Da):24,574
Last modified:May 1, 2000 - v1
Checksum:i36B1E3CA014E1C66
GO
Isoform 2 (identifier: Q9QZC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-221: RDNDSDLALGMLAGAATGMALGSLFWVF → QDYGVRTL

Note: No experimental confirmation available.
Show »
Length:201
Mass (Da):22,624
Checksum:i714670A8A748B318
GO
Isoform 3 (identifier: Q9QZC7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-221: VYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF → NARWLPLPVSAYSGARRRRPPFQLEVK

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):22,923
Checksum:iF0522EF9C64DC397
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81C → W in BAC30448 (PubMed:16141072).Curated1
Sequence conflicti136A → G in BAC38413 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009785178 – 221VYGQQ…LFWVF → NARWLPLPVSAYSGARRRRP PFQLEVK in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_009786194 – 221RDNDS…LFWVF → QDYGVRTL in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF189817 mRNA. Translation: AAF01332.1.
AK039771 mRNA. Translation: BAC30448.1.
AK082118 mRNA. Translation: BAC38413.1.
AK149868 mRNA. Translation: BAE29136.1.
AK150074 mRNA. Translation: BAE29285.1.
AK166091 mRNA. Translation: BAE38565.1.
BC057994 mRNA. Translation: AAH57994.1.
CCDSiCCDS14874.1. [Q9QZC7-1]
CCDS78558.1. [Q9QZC7-3]
RefSeqiNP_663491.1. NM_145516.2. [Q9QZC7-1]
XP_006495961.1. XM_006495898.3. [Q9QZC7-1]
XP_017175721.1. XM_017320232.1. [Q9QZC7-1]
UniGeneiMm.292751.

Genome annotation databases

EnsembliENSMUST00000027297; ENSMUSP00000027297; ENSMUSG00000026123. [Q9QZC7-1]
ENSMUST00000156687; ENSMUSP00000140475; ENSMUSG00000026123. [Q9QZC7-3]
GeneIDi226971.
KEGGimmu:226971.
UCSCiuc007apl.1. mouse. [Q9QZC7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF189817 mRNA. Translation: AAF01332.1.
AK039771 mRNA. Translation: BAC30448.1.
AK082118 mRNA. Translation: BAC38413.1.
AK149868 mRNA. Translation: BAE29136.1.
AK150074 mRNA. Translation: BAE29285.1.
AK166091 mRNA. Translation: BAE38565.1.
BC057994 mRNA. Translation: AAH57994.1.
CCDSiCCDS14874.1. [Q9QZC7-1]
CCDS78558.1. [Q9QZC7-3]
RefSeqiNP_663491.1. NM_145516.2. [Q9QZC7-1]
XP_006495961.1. XM_006495898.3. [Q9QZC7-1]
XP_017175721.1. XM_017320232.1. [Q9QZC7-1]
UniGeneiMm.292751.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DHINMR-A3-109[»]
ProteinModelPortaliQ9QZC7.
SMRiQ9QZC7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000027297.

PTM databases

iPTMnetiQ9QZC7.
PhosphoSitePlusiQ9QZC7.

Proteomic databases

PaxDbiQ9QZC7.
PRIDEiQ9QZC7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027297; ENSMUSP00000027297; ENSMUSG00000026123. [Q9QZC7-1]
ENSMUST00000156687; ENSMUSP00000140475; ENSMUSG00000026123. [Q9QZC7-3]
GeneIDi226971.
KEGGimmu:226971.
UCSCiuc007apl.1. mouse. [Q9QZC7-1]

Organism-specific databases

CTDi55041.
MGIiMGI:2385825. Plekhb2.

Phylogenomic databases

eggNOGiENOG410IFNJ. Eukaryota.
ENOG4111G6I. LUCA.
GeneTreeiENSGT00390000013989.
HOGENOMiHOG000253945.
HOVERGENiHBG060487.
InParanoidiQ9QZC7.
OMAiCINIRMG.
OrthoDBiEOG091G14FB.
PhylomeDBiQ9QZC7.
TreeFamiTF331787.

Miscellaneous databases

ChiTaRSiPlekhb2. mouse.
EvolutionaryTraceiQ9QZC7.
PROiQ9QZC7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000026123.
ExpressionAtlasiQ9QZC7. baseline and differential.
GenevisibleiQ9QZC7. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPKHB2_MOUSE
AccessioniPrimary (citable) accession number: Q9QZC7
Secondary accession number(s): Q3UDH6, Q8C4I4, Q8CA27
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.