Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein quaking

Gene

Qki

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

RNA-binding protein that plays a central role in myelinization (PubMed:10864952, PubMed:11917126). Also required for visceral endoderm function and blood vessel development (PubMed:11892011, PubMed:16470614). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence (PubMed:16041388). Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation, as well as cellular processes including apoptosis, cell cycle, glial cell fate and development (PubMed:10535969, PubMed:12467586, PubMed:11297509, PubMed:11917126, PubMed:15568022). Required to protect and promote stability of mRNAs such as MBP and CDKN1B which promotes oligodendrocyte differentiation (PubMed:10535969, PubMed:15568022). Participates in mRNA transport by regulating the nuclear export of MBP mRNA (PubMed:12467586). May also play a role in smooth muscle development (PubMed:14706070).10 Publications
Isoform 1 is involved in regulation of mRNA splicing of MAG pre-mRNA by acting as a negative regulator of MAG exon 12 alternative splicing.1 Publication
Isoform 3 can induce apoptosis, while heterodimerization with other isoforms results in nuclear translocation of isoform 3 and suppression of apoptosis.1 Publication
Isoform 4 acts as a translational repressor for GLI1.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei97 – 971Involved in RNA bindingBy similarity
Sitei120 – 1201Involved in RNA bindingBy similarity
Sitei124 – 1241Involved in RNA bindingBy similarity
Sitei130 – 1301Involved in RNA bindingBy similarity
Sitei190 – 1901Involved in RNA bindingBy similarity
Sitei193 – 1931Involved in RNA bindingBy similarity

GO - Molecular functioni

  • mRNA binding Source: MGI
  • poly(A) RNA binding Source: MGI
  • RNA binding Source: MGI

GO - Biological processi

  • 3'-UTR-mediated mRNA destabilization Source: MGI
  • axon ensheathment Source: MGI
  • long-chain fatty acid biosynthetic process Source: MGI
  • mRNA processing Source: UniProtKB-KW
  • mRNA transport Source: UniProtKB-KW
  • muscle cell differentiation Source: MGI
  • myelination Source: MGI
  • positive regulation of gene expression Source: MGI
  • RNA splicing Source: UniProtKB-KW
  • spermatid development Source: MGI
  • vasculogenesis Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, mRNA processing, mRNA splicing, mRNA transport, Translation regulation, Transport

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein quaking
Short name:
MqkI
Short name:
qkI
Gene namesi
Name:Qki
Synonyms:Qk, Qk1, Qka1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:97837. Qk.

Subcellular locationi

Isoform 1 :
  • Cytoplasm
  • Nucleus

  • Note: Isoform 1 localizes predominantly in the nucleus and at lower levels in cytoplasm. It shuttles between the cytoplasm and the nucleus.
Isoform 3 :
  • Cytoplasm
  • Nucleus

  • Note: Isoform 3 localizes predominantly in the cytoplasm and at much lower levels in nucleus.
Isoform 4 :

GO - Cellular componenti

  • cytoplasm Source: CACAO
  • nucleus Source: CACAO
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Defects in Qki are the cause of quakingviable (qkv). Qkv is a spontaneous mutation resulting in hypomyelinization of the central and peripheral nervous systems. Mutant mice develop normally until postnatal day 10 when they display rapid tremors or 'quaking' that is especially pronounced in hindlimbs and experience convulsive tonic-clonic seizures as they mature (PubMed:8589716). Mice with qkv specifically lack isoform 3 and isoform 4 in myelin-forming cells, while isoform 1 is lacking in oligodendrocytes of severely affected tracts (PubMed:12888522). Mice with qkv also lack the Park2 gene product, suggesting that the absence of Park2 may also affect the phenotype (PubMed:15014970).

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi48 – 481E → G in qk-Kt4; induces embryonic lethality possibly due to its inability to homodimerize. 3 Publications
Mutagenesisi157 – 1571V → E in qk-k24; induces embryonic lethality possibly due to blood vessel defects; prevents RNA-binding but not homodimerization. 3 Publications
Mutagenesisi276 – 2794PPGP → AAGA: Strongly impairs phosphorylation. 1 Publication
Mutagenesisi285 – 2851Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-288; F-290; F-292 and F-303. 1 Publication
Mutagenesisi288 – 2881Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-290; F-292 and F-303. 1 Publication
Mutagenesisi290 – 2901Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-288; F-292 and F-303. 1 Publication
Mutagenesisi292 – 2921Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-288; F-290 and F-303. 1 Publication
Mutagenesisi303 – 3031Y → F: Abolishes phosphorylation and RNA-binding; when associated with F-285; F-288; F-290 and F-292. 1 Publication
Mutagenesisi324 – 3241R → A: Abolishes nuclear localization; when associated with A-330. 1 Publication
Mutagenesisi328 – 3281Y → F: Does not affect nuclear localization. 1 Publication
Mutagenesisi330 – 3301R → A: Abolishes nuclear localization; when associated with A-324. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 341341Protein quakingPRO_0000239374Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei188 – 1881PhosphoserineBy similarity
Modified residuei242 – 2421Asymmetric dimethylarginine; by CARM1By similarity

Post-translational modificationi

Methylated by PRMT1.1 Publication
Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA. The level of Tyr phosphorylation in the developing myelin is highest in the first postnatal week (P7). During the vigorous accumulation of MBP mRNA between P7 and P20, phosphorylation in the developing myelin drastically declines. By the end of the fourth postnatal week (P28), phosphorylation is reduced approximately 90%.2 Publications

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ9QYS9.
PaxDbiQ9QYS9.
PeptideAtlasiQ9QYS9.
PRIDEiQ9QYS9.

PTM databases

iPTMnetiQ9QYS9.
PhosphoSiteiQ9QYS9.

Expressioni

Tissue specificityi

Highly expressed in myelin-forming cells. Expressed in oligodendrocytes and astrocytes in the central nervous system as well as Schwann cells in the peripheral nervous system. Also expressed in the yolk sac endoderm, adjacent to the mesodermal site of developing blood islands, where the differentiation of blood and endothelial cells first occurs (at protein level). Expressed in brain, lung, heart and testis.3 Publications

Developmental stagei

Expressed in neural progenitors of the ventricular zone (vz) during CNS development, but that expression is down-regulated during neuronal differentiation. By contrast, neural progenitors located in specific subdomains of the vz maintain expression as they differentiate and migrate away into the emerging nervous system. These have characteristics consistent with the acquisition of a glial rather than neuronal fate (at protein level) First detected in the neuroepithelium of the head folds at E7.5. Expression is strongly present ventrally in the nascent brain and neural tube of E8.5 and E9.5 and in the heart of E8.5. Isoform 1 is expressed in early embryos, while isoform 3 and isoform 4 are found in late development when myelination begins.

Gene expression databases

BgeeiENSMUSG00000062078.
CleanExiMM_QK.
GenevisibleiQ9QYS9. MM.

Interactioni

Subunit structurei

Homodimer. Does not require RNA to homodimerize (PubMed:10506177, PubMed:11297509, PubMed:9671495). Able to heterodimerize with BICC1 (PubMed:9315629).4 Publications

Protein-protein interaction databases

BioGridi202529. 1 interaction.
IntActiQ9QYS9. 2 interactions.
MINTiMINT-4105681.
STRINGi10090.ENSMUSP00000095025.

Structurei

Secondary structure

1
341
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi15 – 3016Combined sources
Helixi32 – 354Combined sources
Helixi41 – 5818Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4DNNX-ray2.10A/B14-67[»]
ProteinModelPortaliQ9QYS9.
SMRiQ9QYS9. Positions 12-214.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini87 – 15367KHAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni11 – 8272Qua1 domain; involved in homodimerizationBy similarityAdd
BLAST
Regioni182 – 21332Qua2 domain; involved in RNA bindingBy similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi276 – 2794SH3-binding
Motifi324 – 3307Nuclear localization signal

Domaini

The KH domain and the Qua2 region are involved in RNA binding.By similarity

Sequence similaritiesi

Contains 1 KH domain.Curated

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiKOG1588. Eukaryota.
COG5176. LUCA.
GeneTreeiENSGT00550000074434.
HOVERGENiHBG093883.
InParanoidiQ9QYS9.
KOiK14945.
OMAiTVEDTHN.
OrthoDBiEOG091G0EED.
PhylomeDBiQ9QYS9.
TreeFamiTF314878.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR032367. Quaking_NLS.
IPR032377. STAR_dimer.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
PF16551. Quaking_NLS. 1 hit.
PF16544. STAR_dimer. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QYS9-1) [UniParc]FASTAAdd to basket
Also known as: QKI-5

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVGEMETKEK PKPTPDYLMQ LMNDKKLMSS LPNFCGIFNH LERLLDEEIS
60 70 80 90 100
RVRKDMYNDT LNGSTEKRSA ELPDAVGPIV QLQEKLYVPV KEYPDFNFVG
110 120 130 140 150
RILGPRGLTA KQLEAETGCK IMVRGKGSMR DKKKEEQNRG KPNWEHLNED
160 170 180 190 200
LHVLITVEDA QNRAEIKLKR AVEEVKKLLV PAAEGEDSLK KMQLMELAIL
210 220 230 240 250
NGTYRDANIK SPALAFSLAA TAQAAPRIIT GPAPVLPPAA LRTPTPAGPT
260 270 280 290 300
IMPLIRQIQT AVMPNGTPHP TAAIVPPGPE AGLIYTPYEY PYTLAPATSI
310 320 330 340
LEYPIEPSGV LGAVATKVRR HDMRVHPYQR IVTADRAATG N
Length:341
Mass (Da):37,671
Last modified:May 1, 2000 - v1
Checksum:i43E7F3A426A494C4
GO
Isoform 2 (identifier: Q9QYS9-2) [UniParc]FASTAAdd to basket
Also known as: QKI-7B

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → VWLSQRKAKNSRTVLTEPSSDLNLTNA

Show »
Length:338
Mass (Da):37,352
Checksum:iEC8C3DBF62F7788C
GO
Isoform 3 (identifier: Q9QYS9-3) [UniParc]FASTAAdd to basket
Also known as: QkI-7

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH

Show »
Length:325
Mass (Da):35,978
Checksum:iB4B2DA898F0145B3
GO
Isoform 4 (identifier: Q9QYS9-4) [UniParc]FASTAAdd to basket
Also known as: QKI-6, QKI-5B

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GMAFPTKG

Show »
Length:319
Mass (Da):35,131
Checksum:iD1427E54B0BF54E7
GO
Isoform 5 (identifier: Q9QYS9-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     183-187: AEGED → VSKFS
     188-341: Missing.

Show »
Length:187
Mass (Da):21,425
Checksum:i48E9008C98E4E18B
GO
Isoform 6 (identifier: Q9QYS9-6) [UniParc]FASTAAdd to basket
Also known as: QKI-7B

The sequence of this isoform differs from the canonical sequence as follows:
     213-220: Missing.
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → VWLSQRKAKNSRTVLTEPSSDLNLTNA

Show »
Length:330
Mass (Da):36,607
Checksum:iD796B25FA5782A1E
GO
Isoform 7 (identifier: Q9QYS9-7) [UniParc]FASTAAdd to basket
Also known as: QKI-5A

The sequence of this isoform differs from the canonical sequence as follows:
     341-341: N → NVNW

Show »
Length:344
Mass (Da):38,070
Checksum:i9B712023E7F3A426
GO
Isoform 8 (identifier: Q9QYS9-8) [UniParc]FASTAAdd to basket
Also known as: QKI-G

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GKYDSCTM

Show »
Length:319
Mass (Da):35,227
Checksum:iDFB0F14663C9D147
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti276 – 2761P → A in BAB23859 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei183 – 1875AEGED → VSKFS in isoform 5. CuratedVSP_019192
Alternative sequencei188 – 341154Missing in isoform 5. CuratedVSP_019193Add
BLAST
Alternative sequencei213 – 2208Missing in isoform 6. CuratedVSP_019194
Alternative sequencei312 – 34130GAVAT…AATGN → VWLSQRKAKNSRTVLTEPSS DLNLTNA in isoform 2 and isoform 6. 1 PublicationVSP_019195Add
BLAST
Alternative sequencei312 – 34130GAVAT…AATGN → EWIEMPVMPDISAH in isoform 3. 2 PublicationsVSP_019196Add
BLAST
Alternative sequencei312 – 34130GAVAT…AATGN → GMAFPTKG in isoform 4. 1 PublicationVSP_019197Add
BLAST
Alternative sequencei312 – 34130GAVAT…AATGN → GKYDSCTM in isoform 8. CuratedVSP_019198Add
BLAST
Alternative sequencei341 – 3411N → NVNW in isoform 7. 1 PublicationVSP_019199

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44940 mRNA. Translation: AAC52491.1.
AF090402 mRNA. Translation: AAC99452.1.
AF090403 mRNA. Translation: AAC99453.1.
AF090404 mRNA. Translation: AAC99454.1.
AF091047 mRNA. Translation: AAC63042.1.
AF090401
, AF090392, AF090393, AF090394, AF090395, AF090396, AF090397, AF090400 Genomic DNA. Translation: AAD53329.1.
AF090397
, AF090392, AF090393, AF090394, AF090395, AF090396 Genomic DNA. Translation: AAD53330.1.
AF090397
, AF090392, AF090393, AF090395, AF090396, AF090394 Genomic DNA. Translation: AAD53331.1.
AF090396
, AF090392, AF090393, AF090394, AF090395 Genomic DNA. Translation: AAD53332.1.
AF467890 Genomic DNA. Translation: AAM21006.1.
AF467890 Genomic DNA. Translation: AAM21007.1.
AF467890 Genomic DNA. Translation: AAM21008.1.
AF467890 Genomic DNA. Translation: AAM21009.1.
AF467890 Genomic DNA. Translation: AAM21010.1.
AK005169 mRNA. Translation: BAB23859.1.
AK132303 mRNA. Translation: BAE21091.1.
BC053426 mRNA. Translation: AAH53426.1.
BC056346 mRNA. Translation: AAH56346.1.
AJ012812
, AJ012813, AJ012814, AJ012816, AJ012817, AJ012815 Genomic DNA. Translation: CAB37614.1.
AJ012812
, AJ012813, AJ012814, AJ012818, AJ012816, AJ012815 Genomic DNA. Translation: CAB37615.1.
AJ012812
, AJ012813, AJ012814, AJ012816, AJ012820, AJ012819, AJ012815 Genomic DNA. Translation: CAB37616.1.
CCDSiCCDS28387.1. [Q9QYS9-3]
CCDS49947.1. [Q9QYS9-1]
RefSeqiNP_001152988.1. NM_001159516.1. [Q9QYS9-4]
NP_001152989.1. NM_001159517.1. [Q9QYS9-1]
NP_068681.1. NM_021881.2. [Q9QYS9-3]
UniGeneiMm.130694.
Mm.384135.
Mm.393248.

Genome annotation databases

EnsembliENSMUST00000042296; ENSMUSP00000046740; ENSMUSG00000062078. [Q9QYS9-3]
ENSMUST00000097414; ENSMUSP00000095025; ENSMUSG00000062078. [Q9QYS9-1]
GeneIDi19317.
KEGGimmu:19317.
UCSCiuc008akb.2. mouse. [Q9QYS9-1]
uc008ake.2. mouse. [Q9QYS9-4]
uc012ajv.1. mouse. [Q9QYS9-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44940 mRNA. Translation: AAC52491.1.
AF090402 mRNA. Translation: AAC99452.1.
AF090403 mRNA. Translation: AAC99453.1.
AF090404 mRNA. Translation: AAC99454.1.
AF091047 mRNA. Translation: AAC63042.1.
AF090401
, AF090392, AF090393, AF090394, AF090395, AF090396, AF090397, AF090400 Genomic DNA. Translation: AAD53329.1.
AF090397
, AF090392, AF090393, AF090394, AF090395, AF090396 Genomic DNA. Translation: AAD53330.1.
AF090397
, AF090392, AF090393, AF090395, AF090396, AF090394 Genomic DNA. Translation: AAD53331.1.
AF090396
, AF090392, AF090393, AF090394, AF090395 Genomic DNA. Translation: AAD53332.1.
AF467890 Genomic DNA. Translation: AAM21006.1.
AF467890 Genomic DNA. Translation: AAM21007.1.
AF467890 Genomic DNA. Translation: AAM21008.1.
AF467890 Genomic DNA. Translation: AAM21009.1.
AF467890 Genomic DNA. Translation: AAM21010.1.
AK005169 mRNA. Translation: BAB23859.1.
AK132303 mRNA. Translation: BAE21091.1.
BC053426 mRNA. Translation: AAH53426.1.
BC056346 mRNA. Translation: AAH56346.1.
AJ012812
, AJ012813, AJ012814, AJ012816, AJ012817, AJ012815 Genomic DNA. Translation: CAB37614.1.
AJ012812
, AJ012813, AJ012814, AJ012818, AJ012816, AJ012815 Genomic DNA. Translation: CAB37615.1.
AJ012812
, AJ012813, AJ012814, AJ012816, AJ012820, AJ012819, AJ012815 Genomic DNA. Translation: CAB37616.1.
CCDSiCCDS28387.1. [Q9QYS9-3]
CCDS49947.1. [Q9QYS9-1]
RefSeqiNP_001152988.1. NM_001159516.1. [Q9QYS9-4]
NP_001152989.1. NM_001159517.1. [Q9QYS9-1]
NP_068681.1. NM_021881.2. [Q9QYS9-3]
UniGeneiMm.130694.
Mm.384135.
Mm.393248.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4DNNX-ray2.10A/B14-67[»]
ProteinModelPortaliQ9QYS9.
SMRiQ9QYS9. Positions 12-214.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202529. 1 interaction.
IntActiQ9QYS9. 2 interactions.
MINTiMINT-4105681.
STRINGi10090.ENSMUSP00000095025.

PTM databases

iPTMnetiQ9QYS9.
PhosphoSiteiQ9QYS9.

Proteomic databases

MaxQBiQ9QYS9.
PaxDbiQ9QYS9.
PeptideAtlasiQ9QYS9.
PRIDEiQ9QYS9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000042296; ENSMUSP00000046740; ENSMUSG00000062078. [Q9QYS9-3]
ENSMUST00000097414; ENSMUSP00000095025; ENSMUSG00000062078. [Q9QYS9-1]
GeneIDi19317.
KEGGimmu:19317.
UCSCiuc008akb.2. mouse. [Q9QYS9-1]
uc008ake.2. mouse. [Q9QYS9-4]
uc012ajv.1. mouse. [Q9QYS9-3]

Organism-specific databases

CTDi19317.
MGIiMGI:97837. Qk.

Phylogenomic databases

eggNOGiKOG1588. Eukaryota.
COG5176. LUCA.
GeneTreeiENSGT00550000074434.
HOVERGENiHBG093883.
InParanoidiQ9QYS9.
KOiK14945.
OMAiTVEDTHN.
OrthoDBiEOG091G0EED.
PhylomeDBiQ9QYS9.
TreeFamiTF314878.

Miscellaneous databases

PROiQ9QYS9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000062078.
CleanExiMM_QK.
GenevisibleiQ9QYS9. MM.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
IPR032367. Quaking_NLS.
IPR032377. STAR_dimer.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
PF16551. Quaking_NLS. 1 hit.
PF16544. STAR_dimer. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiQKI_MOUSE
AccessioniPrimary (citable) accession number: Q9QYS9
Secondary accession number(s): O88972
, Q61110, Q78ZE4, Q78ZE5, Q8K4X9, Q8K4Y0, Q9CW34, Q9QUH4, Q9R2A8, Q9Z246
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: May 1, 2000
Last modified: September 7, 2016
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.