Q9QYE3 (BC11A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: B-cell lymphoma/leukemia 11A Short name=BCL-11A Alternative name(s): B-cell CLL/lymphoma 11A COUP-TF-interacting protein 1 Ecotropic viral integration site 9 protein Short name=EVI-9 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 773 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. Ref.6 |
| Subunit structure | |
| Subcellular location | Cytoplasm. Nucleus. Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles. Ref.7 |
| Tissue specificity | Isoforms are expressed in a tissue-specific fashion. Isoforms 1, isoform 2, and isoform 3 are expressed at similar levels in testis, kidney and spleen. Isoform 1 is expressed in the stomach, and isoform 2 is expressed exclusively in the lung. Overexpression following proviral integration in hematopoietic cells results in the generation of myeloid leukemia. |
| Developmental stage | Highly expressed in the developing embryo. |
| Post-translational modification | Sumoylated with SUMO1. Ref.7 |
| Sequence similarities | Contains 3 C2H2-type zinc fingers. |
| Sequence caution | The sequence AAF63682.1 differs from that shown. Reason: Frameshift at position 744. The sequence BAC65839.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9QYE3-1) Also known as: a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9QYE3-10) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 1-286: Missing. 726-773: Missing. | ||||||
| Isoform 3 (identifier: Q9QYE3-11) Also known as: c; The sequence of this isoform differs from the canonical sequence as follows: 212-744: Missing. | ||||||
| Isoform 4 (identifier: Q9QYE3-12) The sequence of this isoform differs from the canonical sequence as follows: 1-423: Missing. 745-773: PSHTPVRRSTPRAQDVWQFSDGSSRTLKF → EYCGKVFKNC...RVLNNDIKTE | ||||||
| Isoform 5 (identifier: Q9QYE3-13) The sequence of this isoform differs from the canonical sequence as follows: 212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL 244-773: Missing. | ||||||
| Isoform 6 (identifier: Q9QYE3-14) The sequence of this isoform differs from the canonical sequence as follows: 1-52: Missing. 212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL 244-773: Missing. | ||||||
| Isoform 7 (identifier: Q9QYE3-15) The sequence of this isoform differs from the canonical sequence as follows: 131-773: Missing. | ||||||
| Isoform 8 (identifier: Q9QYE3-16) The sequence of this isoform differs from the canonical sequence as follows: 1-286: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 773 | 773 | B-cell lymphoma/leukemia 11A | PRO_0000047103 | |||||
Regions | |||||||||
| Zinc finger | 170 – 193 | 24 | C2H2-type 1 | ||||||
| Zinc finger | 377 – 399 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 405 – 429 | 25 | C2H2-type 3 | ||||||
| Region | 1 – 210 | 210 | Required for nuclear body formation and for SUMO1 recruitment | ||||||
| Compositional bias | 260 – 373 | 114 | Pro-rich | ||||||
| Compositional bias | 481 – 509 | 29 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 205 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 332 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 608 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 625 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 630 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 701 | 1 | Phosphothreonine By similarity | ||||||
| Cross-link | 634 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) Ref.7 | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 423 | 423 | Missing in isoform 4. | VSP_009556 | |||||
| Alternative sequence | 1 – 286 | 286 | Missing in isoform 2 and isoform 8. | VSP_009557 | |||||
| Alternative sequence | 1 – 52 | 52 | Missing in isoform 6. | VSP_009558 | |||||
| Alternative sequence | 131 – 773 | 643 | Missing in isoform 7. | VSP_009559 | |||||
| Alternative sequence | 212 – 744 | 533 | Missing in isoform 3. | VSP_009560 | |||||
| Alternative sequence | 212 – 243 | 32 | GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAQEPLSSEKL in isoform 5 and isoform 6. | VSP_009561 | |||||
| Alternative sequence | 244 – 773 | 530 | Missing in isoform 5 and isoform 6. | VSP_009562 | |||||
| Alternative sequence | 726 – 773 | 48 | Missing in isoform 2. | VSP_009563 | |||||
| Alternative sequence | 745 – 773 | 29 | PSHTP…RTLKF → EYCGKVFKNCSNLTVHRRSH TGERPYKCELCNYACAQSSK LTRHMKTHGQVGKDVYKCEI CKMPFSVYSTLEKHMKKWHS DRVLNNDIKTE in isoform 4. | VSP_009564 | |||||
Experimental info | |||||||||
| Mutagenesis | 123 | 1 | K → R: No effect on sumoylation. Ref.7 | ||||||
| Mutagenesis | 637 | 1 | K → R: Abolishes sumoylation. No effect on nuclear body location. Ref.7 | ||||||
| Sequence conflict | 104 | 1 | Q → K in BAB23285. Ref.3 | ||||||
| Sequence conflict | 129 | 1 | D → G in BAC65839. Ref.4 | ||||||
| Sequence conflict | 211 | 1 | V → G in AAF65929. Ref.1 | ||||||
| Sequence conflict | 673 | 1 | F → L in AAF63682. Ref.2 | ||||||
| Sequence conflict | 699 | 1 | F → L in AAF65928. Ref.1 | ||||||
| Sequence conflict | 743 | 1 | T → I in AAF63682. Ref.2 | ||||||
| Sequence conflict | 773 | 1 | F → L in AAF63682. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Evi9 encodes a novel zinc finger protein that physically interacts with BCL6, a known human B-cell proto-oncogene product." Nakamura T., Yamazaki Y., Saiki Y., Moriyama M., Largaespada D.A., Jenkins N.A., Copeland N.G. Mol. Cell. Biol. 20:3178-3186(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Strain: BXH/2. |
| [2] | "Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors." Avram D., Fields A., Pretty On Top K., Nevrivy D.J., Ishmael J.E., Leid M. J. Biol. Chem. 275:10315-10322(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH TFCOUP1; EAR2 AND ARP1. Strain: BALB/c. Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6). Strain: C57BL/6J. Tissue: Brain, Brain cortex, Corpora quadrigemina, Embryo and Spinal cord. |
| [4] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). Tissue: Brain. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8). Strain: FVB/N-3. Tissue: Mammary tumor. |
| [6] | "Bcl11a is essential for normal lymphoid development." Liu P., Keller J.R., Ortiz M., Tessarollo L., Rachel R.A., Nakamura T., Jenkins N.A., Copeland N.G. Nat. Immunol. 4:525-532(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "BCL11A is a SUMOylated protein and recruits SUMO-conjugation enzymes in its nuclear body." Kuwata T., Nakamura T. Genes Cells 13:931-940(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUMOYLATION AT LYS-634, INTERACTION WITH PIAS3, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-123 AND LYS-637. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF051525 mRNA. Translation: AAF22430.1. AF169036 mRNA. Translation: AAF65928.1. AF169037 mRNA. Translation: AAF65929.1. AF186018 mRNA. Translation: AAF63682.1. Frameshift. AK004395 mRNA. Translation: BAB23285.1. AK043677 mRNA. Translation: BAC31616.1. AK045556 mRNA. Translation: BAC32416.1. AK049700 mRNA. Translation: BAC33881.1. AK122557 mRNA. Translation: BAC65839.1. Different initiation. BC010585 mRNA. Translation: AAH10585.1. BC051418 mRNA. Translation: AAH51418.1. |
| IPI | IPI00267748. IPI00272308. IPI00405328. IPI00405329. IPI00405330. IPI00405331. IPI00405332. IPI00405333. |
| PIR | PT0706. |
| RefSeq | NP_001152761.1. NM_001159289.1. NP_001152762.1. NM_001159290.1. NP_001229863.1. NM_001242934.1. NP_057916.1. NM_016707.3. |
| UniGene | Mm.53687. |
3D structure databases | |
| ProteinModelPortal | Q9QYE3. |
| SMR | Q9QYE3. Positions 45-75, 165-202, 379-427. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q9QYE3. |
Proteomic databases | |
| PaxDb | Q9QYE3. |
| PRIDE | Q9QYE3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000000881; ENSMUSP00000000881; ENSMUSG00000000861. ENSMUST00000109516; ENSMUSP00000105142; ENSMUSG00000000861. ENSMUST00000118955; ENSMUSP00000112948; ENSMUSG00000000861. |
| GeneID | 14025. |
| KEGG | mmu:14025. |
| UCSC | uc007ifs.2. mouse. |
Organism-specific databases | |
| CTD | 53335. |
| MGI | MGI:106190. Bcl11a. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG271772. |
| GeneTree | ENSGT00530000063542. |
| HOVERGEN | HBG050673. |
| OrthoDB | EOG405S0N. |
Gene expression databases | |
| ArrayExpress | Q9QYE3. |
| Bgee | Q9QYE3. |
| CleanEx | MM_BCL11A. |
| Genevestigator | Q9QYE3. |
| GermOnline | ENSMUSG00000000861. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 2 hits. |
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 3 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 3 hits. PS50157. ZINC_FINGER_C2H2_2. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BCL11A. mouse. |
| NextBio | 284944. |
| SOURCE | Search... |
Entry information
| Entry name | BC11A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QYE3 Secondary accession number(s): Q80T89 Q9JLK9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
