Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QYE3

- BC11A_MOUSE

UniProt

Q9QYE3 - BC11A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

B-cell lymphoma/leukemia 11A

Gene

Bcl11a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri377 – 39923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri405 – 42925C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. RNA polymerase II core promoter proximal region sequence-specific DNA binding Source: Ensembl
  3. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription Source: Ensembl
  4. transcription corepressor activity Source: MGI

GO - Biological processi

  1. B cell differentiation Source: MGI
  2. negative regulation of collateral sprouting Source: Ensembl
  3. negative regulation of dendrite development Source: Ensembl
  4. negative regulation of gene expression Source: MGI
  5. positive regulation of collateral sprouting Source: Ensembl
  6. positive regulation of neuron projection development Source: Ensembl
  7. protein sumoylation Source: UniProtKB
  8. T cell differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
B-cell lymphoma/leukemia 11A
Short name:
BCL-11A
Alternative name(s):
B-cell CLL/lymphoma 11A
COUP-TF-interacting protein 1
Ecotropic viral integration site 9 protein
Short name:
EVI-9
Gene namesi
Name:Bcl11a
Synonyms:Ctip1, Evi9, Kiaa1809
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:106190. Bcl11a.

Subcellular locationi

Cytoplasm 1 Publication. Nucleus 1 Publication
Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. nuclear body Source: UniProtKB
  3. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi123 – 1231K → R: No effect on sumoylation. 1 Publication
Mutagenesisi637 – 6371K → R: Abolishes sumoylation. No effect on nuclear body location. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 773773B-cell lymphoma/leukemia 11APRO_0000047103Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei205 – 2051PhosphoserineBy similarity
Modified residuei332 – 3321PhosphoserineBy similarity
Modified residuei608 – 6081PhosphoserineBy similarity
Modified residuei625 – 6251PhosphoserineBy similarity
Modified residuei630 – 6301PhosphoserineBy similarity
Cross-linki634 – 634Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1)
Modified residuei701 – 7011PhosphothreonineBy similarity

Post-translational modificationi

Sumoylated with SUMO1.1 Publication

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ9QYE3.
PaxDbiQ9QYE3.
PRIDEiQ9QYE3.

PTM databases

PhosphoSiteiQ9QYE3.

Expressioni

Tissue specificityi

Isoforms are expressed in a tissue-specific fashion. Isoforms 1, isoform 2, and isoform 3 are expressed at similar levels in testis, kidney and spleen. Isoform 1 is expressed in the stomach, and isoform 2 is expressed exclusively in the lung. Overexpression following proviral integration in hematopoietic cells results in the generation of myeloid leukemia.

Developmental stagei

Highly expressed in the developing embryo.

Gene expression databases

BgeeiQ9QYE3.
CleanExiMM_BCL11A.
ExpressionAtlasiQ9QYE3. baseline and differential.
GenevestigatoriQ9QYE3.

Interactioni

Subunit structurei

Interacts with TFCOUP1, PIAS3, ARP1 and EAR2.2 Publications

Protein-protein interaction databases

BioGridi199546. 3 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9QYE3.
SMRiQ9QYE3. Positions 45-74, 165-202, 379-427.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 210210Required for nuclear body formation and for SUMO1 recruitmentAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi260 – 373114Pro-richAdd
BLAST
Compositional biasi481 – 50929Glu-richAdd
BLAST

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri377 – 39923C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri405 – 42925C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG271772.
GeneTreeiENSGT00530000063542.
HOVERGENiHBG050673.
InParanoidiQ9QYE3.
OMAiFRMEAQE.
OrthoDBiEOG7MH0XP.
PhylomeDBiQ9QYE3.
TreeFamiTF318131.

Family and domain databases

Gene3Di3.30.160.60. 2 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9QYE3-1) [UniParc]FASTAAdd to Basket

Also known as: a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRRKQGKPQ HLSKREFSPE PLEAILTDDE PDHGPLGAPE GDHDLLTCGQ
60 70 80 90 100
CQMNFPLGDI LIFIEHKRKQ CNGSLCLEKG VDKPPSPSPI EMKKASNPVE
110 120 130 140 150
VGIQVTPEDD DCLSTSSRGI CPKQEHIADK LLHWRGLSSP RSAHGALIPT
160 170 180 190 200
PGMSAEYAPQ GICKDEPSSY TCTTCKQPFT SAWFLLQHAQ NTHGLRIYLE
210 220 230 240 250
SEHGSPLTPR VGIPSGLGAE CPSQPPLHGI HIADNNPFNL LRIPGSVSRE
260 270 280 290 300
ASGLAEGRFP PTPPLFSPPP RHHLDPHRIE RLGAEEMALA THHPSAFDRV
310 320 330 340 350
LRLNPMAMEP PAMDFSRRLR ELAGNTSSPP LSPGRPSPMQ RLLQPFQPGS
360 370 380 390 400
KPPFLATPPL PPLQSAPPPS QPPVKSKSCE FCGKTFKFQS NLVVHRRSHT
410 420 430 440 450
GEKPYKCNLC DHACTQASKL KRHMKTHMHK SSPMTVKSDD GLSTASSPEP
460 470 480 490 500
GTSDLVGSAS SALKSVVAKF KSENDPNLIP ENGDEEEEED DEEEEEEEEE
510 520 530 540 550
EEEELTESER VDYGFGLSLE AARHHENSSR GAVVGVGDEG RALPDVMQGM
560 570 580 590 600
VLSSMQHFSE AFHQVLGEKH KRSHLAEAEG HRDTCDEDSV AGESDRIDDG
610 620 630 640 650
TVNGRGCSPG ESASGGLSKK LLLGSPSSLS PFSKRIKLEK EFDLPPAAMP
660 670 680 690 700
NTENVYSQWL AGYAASRQLK DPFLTFGDSR QSPFASSSEH SSENGSLRFS
710 720 730 740 750
TPPGELDGGI SGRSGTGSGG STPHISGPGP GRPSSKEGRR SDTCPSHTPV
760 770
RRSTPRAQDV WQFSDGSSRT LKF
Length:773
Mass (Da):83,855
Last modified:May 1, 2000 - v1
Checksum:i3BD10B7F14AA9EC4
GO
Isoform 2 (identifier: Q9QYE3-10) [UniParc]FASTAAdd to Basket

Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: Missing.
     726-773: Missing.

Show »
Length:439
Mass (Da):47,399
Checksum:i120BF060E661E99B
GO
Isoform 3 (identifier: Q9QYE3-11) [UniParc]FASTAAdd to Basket

Also known as: c

The sequence of this isoform differs from the canonical sequence as follows:
     212-744: Missing.

Show »
Length:240
Mass (Da):26,553
Checksum:i569B5B4CC3C20E2E
GO
Isoform 4 (identifier: Q9QYE3-12) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-423: Missing.
     745-773: PSHTPVRRSTPRAQDVWQFSDGSSRTLKF → EYCGKVFKNC...RVLNNDIKTE

Show »
Length:412
Mass (Da):44,826
Checksum:i1A2AFD70252887C1
GO
Isoform 5 (identifier: Q9QYE3-13) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
     244-773: Missing.

Show »
Length:243
Mass (Da):26,824
Checksum:iB19C19FD90473679
GO
Isoform 6 (identifier: Q9QYE3-14) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
     244-773: Missing.

Show »
Length:191
Mass (Da):21,075
Checksum:i23B17797A92CF20B
GO
Isoform 7 (identifier: Q9QYE3-15) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-773: Missing.

Show »
Length:130
Mass (Da):14,310
Checksum:iE9335B3326D95236
GO
Isoform 8 (identifier: Q9QYE3-16) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: Missing.

Show »
Length:487
Mass (Da):52,639
Checksum:iC96493A37D33CDC0
GO

Sequence cautioni

The sequence AAF63682.1 differs from that shown. Reason: Frameshift at position 744. Curated
The sequence BAC65839.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti104 – 1041Q → K in BAB23285. (PubMed:16141072)Curated
Sequence conflicti129 – 1291D → G in BAC65839. (PubMed:12693553)Curated
Sequence conflicti211 – 2111V → G in AAF65929. (PubMed:10757802)Curated
Sequence conflicti673 – 6731F → L in AAF63682. (PubMed:10744719)Curated
Sequence conflicti699 – 6991F → L in AAF65928. (PubMed:10757802)Curated
Sequence conflicti743 – 7431T → I in AAF63682. (PubMed:10744719)Curated
Sequence conflicti773 – 7731F → L in AAF63682. (PubMed:10744719)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 423423Missing in isoform 4. 1 PublicationVSP_009556Add
BLAST
Alternative sequencei1 – 286286Missing in isoform 2 and isoform 8. 2 PublicationsVSP_009557Add
BLAST
Alternative sequencei1 – 5252Missing in isoform 6. 1 PublicationVSP_009558Add
BLAST
Alternative sequencei131 – 773643Missing in isoform 7. 1 PublicationVSP_009559Add
BLAST
Alternative sequencei212 – 744533Missing in isoform 3. 1 PublicationVSP_009560Add
BLAST
Alternative sequencei212 – 24332GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAQEPLSSEKL in isoform 5 and isoform 6. 2 PublicationsVSP_009561Add
BLAST
Alternative sequencei244 – 773530Missing in isoform 5 and isoform 6. 2 PublicationsVSP_009562Add
BLAST
Alternative sequencei726 – 77348Missing in isoform 2. 1 PublicationVSP_009563Add
BLAST
Alternative sequencei745 – 77329PSHTP…RTLKF → EYCGKVFKNCSNLTVHRRSH TGERPYKCELCNYACAQSSK LTRHMKTHGQVGKDVYKCEI CKMPFSVYSTLEKHMKKWHS DRVLNNDIKTE in isoform 4. 1 PublicationVSP_009564Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF051525 mRNA. Translation: AAF22430.1.
AF169036 mRNA. Translation: AAF65928.1.
AF169037 mRNA. Translation: AAF65929.1.
AF186018 mRNA. Translation: AAF63682.1. Frameshift.
AK004395 mRNA. Translation: BAB23285.1.
AK043677 mRNA. Translation: BAC31616.1.
AK045556 mRNA. Translation: BAC32416.1.
AK049700 mRNA. Translation: BAC33881.1.
AK122557 mRNA. Translation: BAC65839.1. Different initiation.
BC010585 mRNA. Translation: AAH10585.1.
BC051418 mRNA. Translation: AAH51418.1.
CCDSiCCDS24483.1. [Q9QYE3-1]
CCDS48758.1. [Q9QYE3-13]
CCDS48759.1. [Q9QYE3-14]
PIRiPT0706.
RefSeqiNP_001152761.1. NM_001159289.1.
NP_001152762.1. NM_001159290.1. [Q9QYE3-14]
NP_001229863.1. NM_001242934.1.
NP_057916.1. NM_016707.3. [Q9QYE3-1]
UniGeneiMm.53687.

Genome annotation databases

EnsembliENSMUST00000000881; ENSMUSP00000000881; ENSMUSG00000000861. [Q9QYE3-1]
ENSMUST00000109516; ENSMUSP00000105142; ENSMUSG00000000861. [Q9QYE3-13]
ENSMUST00000118955; ENSMUSP00000112948; ENSMUSG00000000861. [Q9QYE3-14]
GeneIDi14025.
KEGGimmu:14025.
UCSCiuc007ifs.2. mouse. [Q9QYE3-15]
uc007ifu.2. mouse. [Q9QYE3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF051525 mRNA. Translation: AAF22430.1 .
AF169036 mRNA. Translation: AAF65928.1 .
AF169037 mRNA. Translation: AAF65929.1 .
AF186018 mRNA. Translation: AAF63682.1 . Frameshift.
AK004395 mRNA. Translation: BAB23285.1 .
AK043677 mRNA. Translation: BAC31616.1 .
AK045556 mRNA. Translation: BAC32416.1 .
AK049700 mRNA. Translation: BAC33881.1 .
AK122557 mRNA. Translation: BAC65839.1 . Different initiation.
BC010585 mRNA. Translation: AAH10585.1 .
BC051418 mRNA. Translation: AAH51418.1 .
CCDSi CCDS24483.1. [Q9QYE3-1 ]
CCDS48758.1. [Q9QYE3-13 ]
CCDS48759.1. [Q9QYE3-14 ]
PIRi PT0706.
RefSeqi NP_001152761.1. NM_001159289.1.
NP_001152762.1. NM_001159290.1. [Q9QYE3-14 ]
NP_001229863.1. NM_001242934.1.
NP_057916.1. NM_016707.3. [Q9QYE3-1 ]
UniGenei Mm.53687.

3D structure databases

ProteinModelPortali Q9QYE3.
SMRi Q9QYE3. Positions 45-74, 165-202, 379-427.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 199546. 3 interactions.

PTM databases

PhosphoSitei Q9QYE3.

Proteomic databases

MaxQBi Q9QYE3.
PaxDbi Q9QYE3.
PRIDEi Q9QYE3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000000881 ; ENSMUSP00000000881 ; ENSMUSG00000000861 . [Q9QYE3-1 ]
ENSMUST00000109516 ; ENSMUSP00000105142 ; ENSMUSG00000000861 . [Q9QYE3-13 ]
ENSMUST00000118955 ; ENSMUSP00000112948 ; ENSMUSG00000000861 . [Q9QYE3-14 ]
GeneIDi 14025.
KEGGi mmu:14025.
UCSCi uc007ifs.2. mouse. [Q9QYE3-15 ]
uc007ifu.2. mouse. [Q9QYE3-1 ]

Organism-specific databases

CTDi 53335.
MGIi MGI:106190. Bcl11a.
Rougei Search...

Phylogenomic databases

eggNOGi NOG271772.
GeneTreei ENSGT00530000063542.
HOVERGENi HBG050673.
InParanoidi Q9QYE3.
OMAi FRMEAQE.
OrthoDBi EOG7MH0XP.
PhylomeDBi Q9QYE3.
TreeFami TF318131.

Miscellaneous databases

NextBioi 284944.
PROi Q9QYE3.
SOURCEi Search...

Gene expression databases

Bgeei Q9QYE3.
CleanExi MM_BCL11A.
ExpressionAtlasi Q9QYE3. baseline and differential.
Genevestigatori Q9QYE3.

Family and domain databases

Gene3Di 3.30.160.60. 2 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 3 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Evi9 encodes a novel zinc finger protein that physically interacts with BCL6, a known human B-cell proto-oncogene product."
    Nakamura T., Yamazaki Y., Saiki Y., Moriyama M., Largaespada D.A., Jenkins N.A., Copeland N.G.
    Mol. Cell. Biol. 20:3178-3186(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: BXH/2.
  2. "Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors."
    Avram D., Fields A., Pretty On Top K., Nevrivy D.J., Ishmael J.E., Leid M.
    J. Biol. Chem. 275:10315-10322(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH TFCOUP1; EAR2 AND ARP1.
    Strain: BALB/c.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
    Strain: C57BL/6J.
    Tissue: Brain, Brain cortex, Corpora quadrigemina, Embryo and Spinal cord.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
    DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Tissue: Brain.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8).
    Strain: FVB/N-3.
    Tissue: Mammary tumor.
  6. Cited for: FUNCTION.
  7. "BCL11A is a SUMOylated protein and recruits SUMO-conjugation enzymes in its nuclear body."
    Kuwata T., Nakamura T.
    Genes Cells 13:931-940(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION AT LYS-634, INTERACTION WITH PIAS3, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-123 AND LYS-637.

Entry informationi

Entry nameiBC11A_MOUSE
AccessioniPrimary (citable) accession number: Q9QYE3
Secondary accession number(s): Q80T89
, Q8BLC7, Q8BLR4, Q8BWX3, Q921V4, Q9D0V2, Q9JIT4, Q9JLK8, Q9JLK9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: May 1, 2000
Last modified: November 26, 2014
This is version 126 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3