Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QYE3

- BC11A_MOUSE

UniProt

Q9QYE3 - BC11A_MOUSE

Protein

B-cell lymphoma/leukemia 11A

Gene

Bcl11a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri377 – 39923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri405 – 42925C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. nucleic acid binding Source: InterPro
    3. protein binding Source: UniProtKB
    4. transcription corepressor activity Source: MGI

    GO - Biological processi

    1. B cell differentiation Source: MGI
    2. negative regulation of gene expression Source: MGI
    3. protein sumoylation Source: UniProtKB
    4. regulation of transcription, DNA-templated Source: UniProtKB-KW
    5. T cell differentiation Source: MGI
    6. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    B-cell lymphoma/leukemia 11A
    Short name:
    BCL-11A
    Alternative name(s):
    B-cell CLL/lymphoma 11A
    COUP-TF-interacting protein 1
    Ecotropic viral integration site 9 protein
    Short name:
    EVI-9
    Gene namesi
    Name:Bcl11a
    Synonyms:Ctip1, Evi9, Kiaa1809
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:106190. Bcl11a.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nuclear body Source: UniProtKB
    3. nucleus Source: MGI

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi123 – 1231K → R: No effect on sumoylation. 1 Publication
    Mutagenesisi637 – 6371K → R: Abolishes sumoylation. No effect on nuclear body location. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 773773B-cell lymphoma/leukemia 11APRO_0000047103Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei205 – 2051PhosphoserineBy similarity
    Modified residuei332 – 3321PhosphoserineBy similarity
    Modified residuei608 – 6081PhosphoserineBy similarity
    Modified residuei625 – 6251PhosphoserineBy similarity
    Modified residuei630 – 6301PhosphoserineBy similarity
    Cross-linki634 – 634Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1)
    Modified residuei701 – 7011PhosphothreonineBy similarity

    Post-translational modificationi

    Sumoylated with SUMO1.1 Publication

    Keywords - PTMi

    Isopeptide bond, Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ9QYE3.
    PaxDbiQ9QYE3.
    PRIDEiQ9QYE3.

    PTM databases

    PhosphoSiteiQ9QYE3.

    Expressioni

    Tissue specificityi

    Isoforms are expressed in a tissue-specific fashion. Isoforms 1, isoform 2, and isoform 3 are expressed at similar levels in testis, kidney and spleen. Isoform 1 is expressed in the stomach, and isoform 2 is expressed exclusively in the lung. Overexpression following proviral integration in hematopoietic cells results in the generation of myeloid leukemia.

    Developmental stagei

    Highly expressed in the developing embryo.

    Gene expression databases

    ArrayExpressiQ9QYE3.
    BgeeiQ9QYE3.
    CleanExiMM_BCL11A.
    GenevestigatoriQ9QYE3.

    Interactioni

    Subunit structurei

    Interacts with TFCOUP1, PIAS3, ARP1 and EAR2.2 Publications

    Protein-protein interaction databases

    BioGridi199546. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QYE3.
    SMRiQ9QYE3. Positions 45-74, 165-202, 379-457.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 210210Required for nuclear body formation and for SUMO1 recruitmentAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi260 – 373114Pro-richAdd
    BLAST
    Compositional biasi481 – 50929Glu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri170 – 19324C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri377 – 39923C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri405 – 42925C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG271772.
    GeneTreeiENSGT00530000063542.
    HOVERGENiHBG050673.
    OMAiFRMEAQE.
    OrthoDBiEOG7MH0XP.
    PhylomeDBiQ9QYE3.
    TreeFamiTF318131.

    Family and domain databases

    Gene3Di3.30.160.60. 2 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 3 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9QYE3-1) [UniParc]FASTAAdd to Basket

    Also known as: a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRRKQGKPQ HLSKREFSPE PLEAILTDDE PDHGPLGAPE GDHDLLTCGQ    50
    CQMNFPLGDI LIFIEHKRKQ CNGSLCLEKG VDKPPSPSPI EMKKASNPVE 100
    VGIQVTPEDD DCLSTSSRGI CPKQEHIADK LLHWRGLSSP RSAHGALIPT 150
    PGMSAEYAPQ GICKDEPSSY TCTTCKQPFT SAWFLLQHAQ NTHGLRIYLE 200
    SEHGSPLTPR VGIPSGLGAE CPSQPPLHGI HIADNNPFNL LRIPGSVSRE 250
    ASGLAEGRFP PTPPLFSPPP RHHLDPHRIE RLGAEEMALA THHPSAFDRV 300
    LRLNPMAMEP PAMDFSRRLR ELAGNTSSPP LSPGRPSPMQ RLLQPFQPGS 350
    KPPFLATPPL PPLQSAPPPS QPPVKSKSCE FCGKTFKFQS NLVVHRRSHT 400
    GEKPYKCNLC DHACTQASKL KRHMKTHMHK SSPMTVKSDD GLSTASSPEP 450
    GTSDLVGSAS SALKSVVAKF KSENDPNLIP ENGDEEEEED DEEEEEEEEE 500
    EEEELTESER VDYGFGLSLE AARHHENSSR GAVVGVGDEG RALPDVMQGM 550
    VLSSMQHFSE AFHQVLGEKH KRSHLAEAEG HRDTCDEDSV AGESDRIDDG 600
    TVNGRGCSPG ESASGGLSKK LLLGSPSSLS PFSKRIKLEK EFDLPPAAMP 650
    NTENVYSQWL AGYAASRQLK DPFLTFGDSR QSPFASSSEH SSENGSLRFS 700
    TPPGELDGGI SGRSGTGSGG STPHISGPGP GRPSSKEGRR SDTCPSHTPV 750
    RRSTPRAQDV WQFSDGSSRT LKF 773
    Length:773
    Mass (Da):83,855
    Last modified:May 1, 2000 - v1
    Checksum:i3BD10B7F14AA9EC4
    GO
    Isoform 2 (identifier: Q9QYE3-10) [UniParc]FASTAAdd to Basket

    Also known as: b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-286: Missing.
         726-773: Missing.

    Show »
    Length:439
    Mass (Da):47,399
    Checksum:i120BF060E661E99B
    GO
    Isoform 3 (identifier: Q9QYE3-11) [UniParc]FASTAAdd to Basket

    Also known as: c

    The sequence of this isoform differs from the canonical sequence as follows:
         212-744: Missing.

    Show »
    Length:240
    Mass (Da):26,553
    Checksum:i569B5B4CC3C20E2E
    GO
    Isoform 4 (identifier: Q9QYE3-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-423: Missing.
         745-773: PSHTPVRRSTPRAQDVWQFSDGSSRTLKF → EYCGKVFKNC...RVLNNDIKTE

    Show »
    Length:412
    Mass (Da):44,826
    Checksum:i1A2AFD70252887C1
    GO
    Isoform 5 (identifier: Q9QYE3-13) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
         244-773: Missing.

    Show »
    Length:243
    Mass (Da):26,824
    Checksum:iB19C19FD90473679
    GO
    Isoform 6 (identifier: Q9QYE3-14) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-52: Missing.
         212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
         244-773: Missing.

    Show »
    Length:191
    Mass (Da):21,075
    Checksum:i23B17797A92CF20B
    GO
    Isoform 7 (identifier: Q9QYE3-15) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         131-773: Missing.

    Show »
    Length:130
    Mass (Da):14,310
    Checksum:iE9335B3326D95236
    GO
    Isoform 8 (identifier: Q9QYE3-16) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-286: Missing.

    Show »
    Length:487
    Mass (Da):52,639
    Checksum:iC96493A37D33CDC0
    GO

    Sequence cautioni

    The sequence AAF63682.1 differs from that shown. Reason: Frameshift at position 744.
    The sequence BAC65839.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti104 – 1041Q → K in BAB23285. (PubMed:16141072)Curated
    Sequence conflicti129 – 1291D → G in BAC65839. (PubMed:12693553)Curated
    Sequence conflicti211 – 2111V → G in AAF65929. (PubMed:10757802)Curated
    Sequence conflicti673 – 6731F → L in AAF63682. (PubMed:10744719)Curated
    Sequence conflicti699 – 6991F → L in AAF65928. (PubMed:10757802)Curated
    Sequence conflicti743 – 7431T → I in AAF63682. (PubMed:10744719)Curated
    Sequence conflicti773 – 7731F → L in AAF63682. (PubMed:10744719)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 423423Missing in isoform 4. 1 PublicationVSP_009556Add
    BLAST
    Alternative sequencei1 – 286286Missing in isoform 2 and isoform 8. 2 PublicationsVSP_009557Add
    BLAST
    Alternative sequencei1 – 5252Missing in isoform 6. 1 PublicationVSP_009558Add
    BLAST
    Alternative sequencei131 – 773643Missing in isoform 7. 1 PublicationVSP_009559Add
    BLAST
    Alternative sequencei212 – 744533Missing in isoform 3. 1 PublicationVSP_009560Add
    BLAST
    Alternative sequencei212 – 24332GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAQEPLSSEKL in isoform 5 and isoform 6. 2 PublicationsVSP_009561Add
    BLAST
    Alternative sequencei244 – 773530Missing in isoform 5 and isoform 6. 2 PublicationsVSP_009562Add
    BLAST
    Alternative sequencei726 – 77348Missing in isoform 2. 1 PublicationVSP_009563Add
    BLAST
    Alternative sequencei745 – 77329PSHTP…RTLKF → EYCGKVFKNCSNLTVHRRSH TGERPYKCELCNYACAQSSK LTRHMKTHGQVGKDVYKCEI CKMPFSVYSTLEKHMKKWHS DRVLNNDIKTE in isoform 4. 1 PublicationVSP_009564Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF051525 mRNA. Translation: AAF22430.1.
    AF169036 mRNA. Translation: AAF65928.1.
    AF169037 mRNA. Translation: AAF65929.1.
    AF186018 mRNA. Translation: AAF63682.1. Frameshift.
    AK004395 mRNA. Translation: BAB23285.1.
    AK043677 mRNA. Translation: BAC31616.1.
    AK045556 mRNA. Translation: BAC32416.1.
    AK049700 mRNA. Translation: BAC33881.1.
    AK122557 mRNA. Translation: BAC65839.1. Different initiation.
    BC010585 mRNA. Translation: AAH10585.1.
    BC051418 mRNA. Translation: AAH51418.1.
    CCDSiCCDS24483.1. [Q9QYE3-1]
    CCDS48758.1. [Q9QYE3-13]
    CCDS48759.1. [Q9QYE3-14]
    PIRiPT0706.
    RefSeqiNP_001152761.1. NM_001159289.1.
    NP_001152762.1. NM_001159290.1. [Q9QYE3-14]
    NP_001229863.1. NM_001242934.1.
    NP_057916.1. NM_016707.3. [Q9QYE3-1]
    UniGeneiMm.53687.

    Genome annotation databases

    EnsembliENSMUST00000000881; ENSMUSP00000000881; ENSMUSG00000000861. [Q9QYE3-1]
    ENSMUST00000109516; ENSMUSP00000105142; ENSMUSG00000000861. [Q9QYE3-13]
    ENSMUST00000118955; ENSMUSP00000112948; ENSMUSG00000000861. [Q9QYE3-14]
    GeneIDi14025.
    KEGGimmu:14025.
    UCSCiuc007ifs.2. mouse. [Q9QYE3-15]
    uc007ifu.2. mouse. [Q9QYE3-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF051525 mRNA. Translation: AAF22430.1 .
    AF169036 mRNA. Translation: AAF65928.1 .
    AF169037 mRNA. Translation: AAF65929.1 .
    AF186018 mRNA. Translation: AAF63682.1 . Frameshift.
    AK004395 mRNA. Translation: BAB23285.1 .
    AK043677 mRNA. Translation: BAC31616.1 .
    AK045556 mRNA. Translation: BAC32416.1 .
    AK049700 mRNA. Translation: BAC33881.1 .
    AK122557 mRNA. Translation: BAC65839.1 . Different initiation.
    BC010585 mRNA. Translation: AAH10585.1 .
    BC051418 mRNA. Translation: AAH51418.1 .
    CCDSi CCDS24483.1. [Q9QYE3-1 ]
    CCDS48758.1. [Q9QYE3-13 ]
    CCDS48759.1. [Q9QYE3-14 ]
    PIRi PT0706.
    RefSeqi NP_001152761.1. NM_001159289.1.
    NP_001152762.1. NM_001159290.1. [Q9QYE3-14 ]
    NP_001229863.1. NM_001242934.1.
    NP_057916.1. NM_016707.3. [Q9QYE3-1 ]
    UniGenei Mm.53687.

    3D structure databases

    ProteinModelPortali Q9QYE3.
    SMRi Q9QYE3. Positions 45-74, 165-202, 379-457.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 199546. 2 interactions.

    PTM databases

    PhosphoSitei Q9QYE3.

    Proteomic databases

    MaxQBi Q9QYE3.
    PaxDbi Q9QYE3.
    PRIDEi Q9QYE3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000000881 ; ENSMUSP00000000881 ; ENSMUSG00000000861 . [Q9QYE3-1 ]
    ENSMUST00000109516 ; ENSMUSP00000105142 ; ENSMUSG00000000861 . [Q9QYE3-13 ]
    ENSMUST00000118955 ; ENSMUSP00000112948 ; ENSMUSG00000000861 . [Q9QYE3-14 ]
    GeneIDi 14025.
    KEGGi mmu:14025.
    UCSCi uc007ifs.2. mouse. [Q9QYE3-15 ]
    uc007ifu.2. mouse. [Q9QYE3-1 ]

    Organism-specific databases

    CTDi 53335.
    MGIi MGI:106190. Bcl11a.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG271772.
    GeneTreei ENSGT00530000063542.
    HOVERGENi HBG050673.
    OMAi FRMEAQE.
    OrthoDBi EOG7MH0XP.
    PhylomeDBi Q9QYE3.
    TreeFami TF318131.

    Miscellaneous databases

    ChiTaRSi BCL11A. mouse.
    NextBioi 284944.
    PROi Q9QYE3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9QYE3.
    Bgeei Q9QYE3.
    CleanExi MM_BCL11A.
    Genevestigatori Q9QYE3.

    Family and domain databases

    Gene3Di 3.30.160.60. 2 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 3 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Evi9 encodes a novel zinc finger protein that physically interacts with BCL6, a known human B-cell proto-oncogene product."
      Nakamura T., Yamazaki Y., Saiki Y., Moriyama M., Largaespada D.A., Jenkins N.A., Copeland N.G.
      Mol. Cell. Biol. 20:3178-3186(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
      Strain: BXH/2.
    2. "Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors."
      Avram D., Fields A., Pretty On Top K., Nevrivy D.J., Ishmael J.E., Leid M.
      J. Biol. Chem. 275:10315-10322(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH TFCOUP1; EAR2 AND ARP1.
      Strain: BALB/c.
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
      Strain: C57BL/6J.
      Tissue: Brain, Brain cortex, Corpora quadrigemina, Embryo and Spinal cord.
    4. "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
      DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
      Tissue: Brain.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8).
      Strain: FVB/N-3.
      Tissue: Mammary tumor.
    6. Cited for: FUNCTION.
    7. "BCL11A is a SUMOylated protein and recruits SUMO-conjugation enzymes in its nuclear body."
      Kuwata T., Nakamura T.
      Genes Cells 13:931-940(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUMOYLATION AT LYS-634, INTERACTION WITH PIAS3, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-123 AND LYS-637.

    Entry informationi

    Entry nameiBC11A_MOUSE
    AccessioniPrimary (citable) accession number: Q9QYE3
    Secondary accession number(s): Q80T89
    , Q8BLC7, Q8BLR4, Q8BWX3, Q921V4, Q9D0V2, Q9JIT4, Q9JLK8, Q9JLK9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 2004
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 124 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3