Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QYE3 (BC11A_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 123. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
B-cell lymphoma/leukemia 11A

Short name=BCL-11A
Alternative name(s):
B-cell CLL/lymphoma 11A
COUP-TF-interacting protein 1
Ecotropic viral integration site 9 protein
Short name=EVI-9
Gene names
Name:Bcl11a
Synonyms:Ctip1, Evi9, Kiaa1809
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length773 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. Ref.6

Subunit structure

Interacts with TFCOUP1, PIAS3, ARP1 and EAR2. Ref.2 Ref.7

Subcellular location

Cytoplasm. Nucleus. Note: Associates with the nuclear body. Colocalizes with SUMO1 and SENP2 in nuclear speckles. Ref.7

Tissue specificity

Isoforms are expressed in a tissue-specific fashion. Isoforms 1, isoform 2, and isoform 3 are expressed at similar levels in testis, kidney and spleen. Isoform 1 is expressed in the stomach, and isoform 2 is expressed exclusively in the lung. Overexpression following proviral integration in hematopoietic cells results in the generation of myeloid leukemia.

Developmental stage

Highly expressed in the developing embryo.

Post-translational modification

Sumoylated with SUMO1. Ref.7

Sequence similarities

Contains 3 C2H2-type zinc fingers.

Sequence caution

The sequence AAF63682.1 differs from that shown. Reason: Frameshift at position 744.

The sequence BAC65839.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9QYE3-1)

Also known as: a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9QYE3-10)

Also known as: b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: Missing.
     726-773: Missing.
Isoform 3 (identifier: Q9QYE3-11)

Also known as: c;

The sequence of this isoform differs from the canonical sequence as follows:
     212-744: Missing.
Isoform 4 (identifier: Q9QYE3-12)

The sequence of this isoform differs from the canonical sequence as follows:
     1-423: Missing.
     745-773: PSHTPVRRSTPRAQDVWQFSDGSSRTLKF → EYCGKVFKNC...RVLNNDIKTE
Isoform 5 (identifier: Q9QYE3-13)

The sequence of this isoform differs from the canonical sequence as follows:
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
     244-773: Missing.
Isoform 6 (identifier: Q9QYE3-14)

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: Missing.
     212-243: GIPSGLGAECPSQPPLHGIHIADNNPFNLLRI → LHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL
     244-773: Missing.
Isoform 7 (identifier: Q9QYE3-15)

The sequence of this isoform differs from the canonical sequence as follows:
     131-773: Missing.
Isoform 8 (identifier: Q9QYE3-16)

The sequence of this isoform differs from the canonical sequence as follows:
     1-286: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 773773B-cell lymphoma/leukemia 11A
PRO_0000047103

Regions

Zinc finger170 – 19324C2H2-type 1
Zinc finger377 – 39923C2H2-type 2
Zinc finger405 – 42925C2H2-type 3
Region1 – 210210Required for nuclear body formation and for SUMO1 recruitment
Compositional bias260 – 373114Pro-rich
Compositional bias481 – 50929Glu-rich

Amino acid modifications

Modified residue2051Phosphoserine By similarity
Modified residue3321Phosphoserine By similarity
Modified residue6081Phosphoserine By similarity
Modified residue6251Phosphoserine By similarity
Modified residue6301Phosphoserine By similarity
Modified residue7011Phosphothreonine By similarity
Cross-link634Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO-1) Ref.7

Natural variations

Alternative sequence1 – 423423Missing in isoform 4.
VSP_009556
Alternative sequence1 – 286286Missing in isoform 2 and isoform 8.
VSP_009557
Alternative sequence1 – 5252Missing in isoform 6.
VSP_009558
Alternative sequence131 – 773643Missing in isoform 7.
VSP_009559
Alternative sequence212 – 744533Missing in isoform 3.
VSP_009560
Alternative sequence212 – 24332GIPSG…NLLRI → LHTPPFGVVPRELKMCGSFR MEAQEPLSSEKL in isoform 5 and isoform 6.
VSP_009561
Alternative sequence244 – 773530Missing in isoform 5 and isoform 6.
VSP_009562
Alternative sequence726 – 77348Missing in isoform 2.
VSP_009563
Alternative sequence745 – 77329PSHTP…RTLKF → EYCGKVFKNCSNLTVHRRSH TGERPYKCELCNYACAQSSK LTRHMKTHGQVGKDVYKCEI CKMPFSVYSTLEKHMKKWHS DRVLNNDIKTE in isoform 4.
VSP_009564

Experimental info

Mutagenesis1231K → R: No effect on sumoylation. Ref.7
Mutagenesis6371K → R: Abolishes sumoylation. No effect on nuclear body location. Ref.7
Sequence conflict1041Q → K in BAB23285. Ref.3
Sequence conflict1291D → G in BAC65839. Ref.4
Sequence conflict2111V → G in AAF65929. Ref.1
Sequence conflict6731F → L in AAF63682. Ref.2
Sequence conflict6991F → L in AAF65928. Ref.1
Sequence conflict7431T → I in AAF63682. Ref.2
Sequence conflict7731F → L in AAF63682. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (a) [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 3BD10B7F14AA9EC4

FASTA77383,855
        10         20         30         40         50         60 
MSRRKQGKPQ HLSKREFSPE PLEAILTDDE PDHGPLGAPE GDHDLLTCGQ CQMNFPLGDI 

        70         80         90        100        110        120 
LIFIEHKRKQ CNGSLCLEKG VDKPPSPSPI EMKKASNPVE VGIQVTPEDD DCLSTSSRGI 

       130        140        150        160        170        180 
CPKQEHIADK LLHWRGLSSP RSAHGALIPT PGMSAEYAPQ GICKDEPSSY TCTTCKQPFT 

       190        200        210        220        230        240 
SAWFLLQHAQ NTHGLRIYLE SEHGSPLTPR VGIPSGLGAE CPSQPPLHGI HIADNNPFNL 

       250        260        270        280        290        300 
LRIPGSVSRE ASGLAEGRFP PTPPLFSPPP RHHLDPHRIE RLGAEEMALA THHPSAFDRV 

       310        320        330        340        350        360 
LRLNPMAMEP PAMDFSRRLR ELAGNTSSPP LSPGRPSPMQ RLLQPFQPGS KPPFLATPPL 

       370        380        390        400        410        420 
PPLQSAPPPS QPPVKSKSCE FCGKTFKFQS NLVVHRRSHT GEKPYKCNLC DHACTQASKL 

       430        440        450        460        470        480 
KRHMKTHMHK SSPMTVKSDD GLSTASSPEP GTSDLVGSAS SALKSVVAKF KSENDPNLIP 

       490        500        510        520        530        540 
ENGDEEEEED DEEEEEEEEE EEEELTESER VDYGFGLSLE AARHHENSSR GAVVGVGDEG 

       550        560        570        580        590        600 
RALPDVMQGM VLSSMQHFSE AFHQVLGEKH KRSHLAEAEG HRDTCDEDSV AGESDRIDDG 

       610        620        630        640        650        660 
TVNGRGCSPG ESASGGLSKK LLLGSPSSLS PFSKRIKLEK EFDLPPAAMP NTENVYSQWL 

       670        680        690        700        710        720 
AGYAASRQLK DPFLTFGDSR QSPFASSSEH SSENGSLRFS TPPGELDGGI SGRSGTGSGG 

       730        740        750        760        770 
STPHISGPGP GRPSSKEGRR SDTCPSHTPV RRSTPRAQDV WQFSDGSSRT LKF 

« Hide

Isoform 2 (b) [UniParc].

Checksum: 120BF060E661E99B
Show »

FASTA43947,399
Isoform 3 (c) [UniParc].

Checksum: 569B5B4CC3C20E2E
Show »

FASTA24026,553
Isoform 4 [UniParc].

Checksum: 1A2AFD70252887C1
Show »

FASTA41244,826
Isoform 5 [UniParc].

Checksum: B19C19FD90473679
Show »

FASTA24326,824
Isoform 6 [UniParc].

Checksum: 23B17797A92CF20B
Show »

FASTA19121,075
Isoform 7 [UniParc].

Checksum: E9335B3326D95236
Show »

FASTA13014,310
Isoform 8 [UniParc].

Checksum: C96493A37D33CDC0
Show »

FASTA48752,639

References

« Hide 'large scale' references
[1]"Evi9 encodes a novel zinc finger protein that physically interacts with BCL6, a known human B-cell proto-oncogene product."
Nakamura T., Yamazaki Y., Saiki Y., Moriyama M., Largaespada D.A., Jenkins N.A., Copeland N.G.
Mol. Cell. Biol. 20:3178-3186(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
Strain: BXH/2.
[2]"Isolation of a novel family of C(2)H(2) zinc finger proteins implicated in transcriptional repression mediated by chicken ovalbumin upstream promoter transcription factor (COUP-TF) orphan nuclear receptors."
Avram D., Fields A., Pretty On Top K., Nevrivy D.J., Ishmael J.E., Leid M.
J. Biol. Chem. 275:10315-10322(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH TFCOUP1; EAR2 AND ARP1.
Strain: BALB/c.
Tissue: Brain.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
Strain: C57BL/6J.
Tissue: Brain, Brain cortex, Corpora quadrigemina, Embryo and Spinal cord.
[4]"Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H.
DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
Tissue: Brain.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8).
Strain: FVB/N-3.
Tissue: Mammary tumor.
[6]"Bcl11a is essential for normal lymphoid development."
Liu P., Keller J.R., Ortiz M., Tessarollo L., Rachel R.A., Nakamura T., Jenkins N.A., Copeland N.G.
Nat. Immunol. 4:525-532(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[7]"BCL11A is a SUMOylated protein and recruits SUMO-conjugation enzymes in its nuclear body."
Kuwata T., Nakamura T.
Genes Cells 13:931-940(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: SUMOYLATION AT LYS-634, INTERACTION WITH PIAS3, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-123 AND LYS-637.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF051525 mRNA. Translation: AAF22430.1.
AF169036 mRNA. Translation: AAF65928.1.
AF169037 mRNA. Translation: AAF65929.1.
AF186018 mRNA. Translation: AAF63682.1. Frameshift.
AK004395 mRNA. Translation: BAB23285.1.
AK043677 mRNA. Translation: BAC31616.1.
AK045556 mRNA. Translation: BAC32416.1.
AK049700 mRNA. Translation: BAC33881.1.
AK122557 mRNA. Translation: BAC65839.1. Different initiation.
BC010585 mRNA. Translation: AAH10585.1.
BC051418 mRNA. Translation: AAH51418.1.
CCDSCCDS24483.1. [Q9QYE3-1]
CCDS48758.1. [Q9QYE3-13]
CCDS48759.1. [Q9QYE3-14]
PIRPT0706.
RefSeqNP_001152761.1. NM_001159289.1.
NP_001152762.1. NM_001159290.1. [Q9QYE3-14]
NP_001229863.1. NM_001242934.1.
NP_057916.1. NM_016707.3. [Q9QYE3-1]
UniGeneMm.53687.

3D structure databases

ProteinModelPortalQ9QYE3.
SMRQ9QYE3. Positions 45-74, 165-202, 379-457.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid199546. 2 interactions.

PTM databases

PhosphoSiteQ9QYE3.

Proteomic databases

MaxQBQ9QYE3.
PaxDbQ9QYE3.
PRIDEQ9QYE3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000000881; ENSMUSP00000000881; ENSMUSG00000000861. [Q9QYE3-1]
ENSMUST00000109516; ENSMUSP00000105142; ENSMUSG00000000861. [Q9QYE3-13]
ENSMUST00000118955; ENSMUSP00000112948; ENSMUSG00000000861. [Q9QYE3-14]
GeneID14025.
KEGGmmu:14025.
UCSCuc007ifs.2. mouse. [Q9QYE3-15]
uc007ifu.2. mouse. [Q9QYE3-1]

Organism-specific databases

CTD53335.
MGIMGI:106190. Bcl11a.
RougeSearch...

Phylogenomic databases

eggNOGNOG271772.
GeneTreeENSGT00530000063542.
HOVERGENHBG050673.
OMAFRMEAQE.
OrthoDBEOG7MH0XP.
PhylomeDBQ9QYE3.
TreeFamTF318131.

Gene expression databases

ArrayExpressQ9QYE3.
BgeeQ9QYE3.
CleanExMM_BCL11A.
GenevestigatorQ9QYE3.

Family and domain databases

Gene3D3.30.160.60. 2 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSBCL11A. mouse.
NextBio284944.
PROQ9QYE3.
SOURCESearch...

Entry information

Entry nameBC11A_MOUSE
AccessionPrimary (citable) accession number: Q9QYE3
Secondary accession number(s): Q80T89 expand/collapse secondary AC list , Q8BLC7, Q8BLR4, Q8BWX3, Q921V4, Q9D0V2, Q9JIT4, Q9JLK8, Q9JLK9
Entry history
Integrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot