Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-adducin

Gene

Add2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding, Calmodulin-binding

Enzyme and pathway databases

ReactomeiR-MMU-5223345. Miscellaneous transport and binding events.

Names & Taxonomyi

Protein namesi
Recommended name:
Beta-adducin
Alternative name(s):
Add97
Erythrocyte adducin subunit beta
Gene namesi
Name:Add2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:87919. Add2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasmic, membrane-bounded vesicle Source: UniProtKB
  • F-actin capping protein complex Source: MGI
  • membrane Source: MGI
  • plasma membrane Source: UniProtKB-SubCell
  • postsynaptic density Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002185342 – 725Beta-adducinAdd BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1
Modified residuei11PhosphoserineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei55PhosphothreonineBy similarity1
Modified residuei60PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei396PhosphoserineBy similarity1
Modified residuei455PhosphoserineBy similarity1
Modified residuei530PhosphoserineCombined sources1
Modified residuei532PhosphoserineCombined sources1
Modified residuei533PhosphothreonineCombined sources1
Modified residuei535PhosphoserineCombined sources1
Modified residuei594PhosphoserineCombined sources1
Modified residuei598PhosphoserineCombined sources1
Modified residuei602PhosphoserineCombined sources1
Modified residuei606PhosphoserineCombined sources1
Modified residuei612PhosphothreonineBy similarity1
Modified residuei614PhosphoserineCombined sources1
Modified residuei618PhosphoserineCombined sources1
Modified residuei620PhosphoserineCombined sources1
Modified residuei674PhosphothreonineBy similarity1
Modified residuei685PhosphoserineBy similarity1
Modified residuei688PhosphoserineCombined sources1
Modified residuei692PhosphoserineCombined sources1
Modified residuei696PhosphoserineCombined sources1
Modified residuei698PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1
Modified residuei702PhosphoserineBy similarity1
Modified residuei712PhosphoserineBy similarity1
Isoform 2 (identifier: Q9QYB8-2)
Modified residuei561PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9QYB8.
PaxDbiQ9QYB8.
PeptideAtlasiQ9QYB8.
PRIDEiQ9QYB8.

2D gel databases

REPRODUCTION-2DPAGEQ9QYB8.

PTM databases

iPTMnetiQ9QYB8.
PhosphoSitePlusiQ9QYB8.

Expressioni

Gene expression databases

BgeeiENSMUSG00000030000.
CleanExiMM_ADD2.
ExpressionAtlasiQ9QYB8. baseline and differential.
GenevisibleiQ9QYB8. MM.

Interactioni

Subunit structurei

Found in a complex with ADD2, DMTN and SLC2A1. Interacts with SLC2A1 (By similarity). Heterodimer of an alpha and a beta subunit.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi197982. 1 interactor.
IntActiQ9QYB8. 3 interactors.
MINTiMINT-4998363.
STRINGi10090.ENSMUSP00000032069.

Structurei

3D structure databases

ProteinModelPortaliQ9QYB8.
SMRiQ9QYB8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni425 – 444Interaction with calmodulinSequence analysisAdd BLAST20
Regioni703 – 720Interaction with calmodulinSequence analysisAdd BLAST18

Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3699. Eukaryota.
COG0235. LUCA.
GeneTreeiENSGT00390000016462.
HOVERGENiHBG004180.
InParanoidiQ9QYB8.
KOiK18622.
OMAiYKIFHLQ.
OrthoDBiEOG091G0324.
PhylomeDBiQ9QYB8.
TreeFamiTF313003.

Family and domain databases

Gene3Di3.40.225.10. 1 hit.
InterProiIPR027773. ADD2.
IPR001303. Aldolase_II/adducin_N.
[Graphical view]
PANTHERiPTHR10672:SF6. PTHR10672:SF6. 1 hit.
PfamiPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTiSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMiSSF53639. SSF53639. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9QYB8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ
60 70 80 90 100
KKRVTMILQS PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA
110 120 130 140 150
VFPASSMNFS MMTPINDLHT ADSLNLAKGE RLMRCKISSV YRLLDLYGWA
160 170 180 190 200
QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV TASSLIKVNI LGEVVEKGSS
210 220 230 240 250
CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK CGLLPVSHNA
260 270 280 290 300
LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE
310 320 330 340 350
EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS
360 370 380 390 400
TFGPMQKSRL GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI
410 420 430 440 450
PATVTAFVFE EDGVPVPALR QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ
460 470 480 490 500
RNMGSPRPKT TWMKADEVEK SSSGMPIRIE NPNQFVPLYT DPQEVLDMRN
510 520 530 540 550
KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLMSK GDADTKDESE
560 570 580 590 600
ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDIATE KPGSPVKSTP
610 620 630 640 650
ASPVQSPSKA GTKSPAVSPS KTSEDTKKTE VSEANTEPEP VKPEGLVVNG
660 670 680 690 700
KEEEPSVEEA LSKGLGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS
710 720
PSKKKKKFRT PSFLKKSKKK EKVES
Length:725
Mass (Da):80,642
Last modified:January 23, 2007 - v4
Checksum:i479153AB1BD6C0DA
GO
Isoform 2 (identifier: Q9QYB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     532-562: STESQLMSKGDADTKDESEETVPNPFSQLTD → VQQRLPPTEGEVYQTPGAGQGTPESSGPLTP
     563-725: Missing.

Show »
Length:562
Mass (Da):62,816
Checksum:iAECF298E23B44CB8
GO
Isoform 3 (identifier: Q9QYB8-3) [UniParc]FASTAAdd to basket
Also known as: Delta

The sequence of this isoform differs from the canonical sequence as follows:
     284-531: Missing.

Show »
Length:477
Mass (Da):52,522
Checksum:iA15E5687AFD48EF0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti219R → T in AAF29503 (PubMed:10845937).Curated1
Sequence conflicti469E → Q in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti469E → Q in AAF24973 (PubMed:10602987).Curated1
Sequence conflicti518Q → H in BAC25943 (PubMed:16141072).Curated1
Sequence conflicti634A → R in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti666G → V in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti675D → V in AAF29502 (PubMed:10845937).Curated1
Sequence conflicti675D → V in AAF29503 (PubMed:10845937).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022596284 – 531Missing in isoform 3. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_000184532 – 562STESQ…SQLTD → VQQRLPPTEGEVYQTPGAGQ GTPESSGPLTP in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_000185563 – 725Missing in isoform 2. 2 PublicationsAdd BLAST163

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100422 mRNA. Translation: AAF24972.1.
AF100423 mRNA. Translation: AAF24973.1.
AF189769 mRNA. Translation: AAF29502.1.
AF189770 mRNA. Translation: AAF29503.1.
AK014496 mRNA. Translation: BAB29395.1.
AK028425 mRNA. Translation: BAC25943.1.
AK156954 mRNA. Translation: BAE33913.1.
BC046783 mRNA. Translation: AAH46783.1.
BC053032 mRNA. Translation: AAH53032.1.
CCDSiCCDS20308.1. [Q9QYB8-1]
PIRiA60670.
RefSeqiNP_001258786.1. NM_001271857.1. [Q9QYB8-1]
NP_001258787.1. NM_001271858.1. [Q9QYB8-1]
NP_001258788.1. NM_001271859.1. [Q9QYB8-1]
NP_001258789.1. NM_001271860.1. [Q9QYB8-2]
NP_001258790.1. NM_001271861.1. [Q9QYB8-2]
NP_038486.2. NM_013458.5. [Q9QYB8-1]
UniGeneiMm.104155.
Mm.489430.

Genome annotation databases

EnsembliENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000203196; ENSMUSP00000145104; ENSMUSG00000030000. [Q9QYB8-2]
ENSMUST00000203279; ENSMUSP00000145452; ENSMUSG00000030000. [Q9QYB8-3]
ENSMUST00000203366; ENSMUSP00000144849; ENSMUSG00000030000. [Q9QYB8-2]
ENSMUST00000203724; ENSMUSP00000145296; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000203786; ENSMUSP00000144694; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000204059; ENSMUSP00000145160; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000205034; ENSMUSP00000145034; ENSMUSG00000030000. [Q9QYB8-2]
GeneIDi11519.
KEGGimmu:11519.
UCSCiuc009crd.2. mouse. [Q9QYB8-2]
uc009cre.2. mouse. [Q9QYB8-1]
uc012eoj.2. mouse. [Q9QYB8-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100422 mRNA. Translation: AAF24972.1.
AF100423 mRNA. Translation: AAF24973.1.
AF189769 mRNA. Translation: AAF29502.1.
AF189770 mRNA. Translation: AAF29503.1.
AK014496 mRNA. Translation: BAB29395.1.
AK028425 mRNA. Translation: BAC25943.1.
AK156954 mRNA. Translation: BAE33913.1.
BC046783 mRNA. Translation: AAH46783.1.
BC053032 mRNA. Translation: AAH53032.1.
CCDSiCCDS20308.1. [Q9QYB8-1]
PIRiA60670.
RefSeqiNP_001258786.1. NM_001271857.1. [Q9QYB8-1]
NP_001258787.1. NM_001271858.1. [Q9QYB8-1]
NP_001258788.1. NM_001271859.1. [Q9QYB8-1]
NP_001258789.1. NM_001271860.1. [Q9QYB8-2]
NP_001258790.1. NM_001271861.1. [Q9QYB8-2]
NP_038486.2. NM_013458.5. [Q9QYB8-1]
UniGeneiMm.104155.
Mm.489430.

3D structure databases

ProteinModelPortaliQ9QYB8.
SMRiQ9QYB8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi197982. 1 interactor.
IntActiQ9QYB8. 3 interactors.
MINTiMINT-4998363.
STRINGi10090.ENSMUSP00000032069.

PTM databases

iPTMnetiQ9QYB8.
PhosphoSitePlusiQ9QYB8.

2D gel databases

REPRODUCTION-2DPAGEQ9QYB8.

Proteomic databases

EPDiQ9QYB8.
PaxDbiQ9QYB8.
PeptideAtlasiQ9QYB8.
PRIDEiQ9QYB8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000203196; ENSMUSP00000145104; ENSMUSG00000030000. [Q9QYB8-2]
ENSMUST00000203279; ENSMUSP00000145452; ENSMUSG00000030000. [Q9QYB8-3]
ENSMUST00000203366; ENSMUSP00000144849; ENSMUSG00000030000. [Q9QYB8-2]
ENSMUST00000203724; ENSMUSP00000145296; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000203786; ENSMUSP00000144694; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000204059; ENSMUSP00000145160; ENSMUSG00000030000. [Q9QYB8-1]
ENSMUST00000205034; ENSMUSP00000145034; ENSMUSG00000030000. [Q9QYB8-2]
GeneIDi11519.
KEGGimmu:11519.
UCSCiuc009crd.2. mouse. [Q9QYB8-2]
uc009cre.2. mouse. [Q9QYB8-1]
uc012eoj.2. mouse. [Q9QYB8-3]

Organism-specific databases

CTDi119.
MGIiMGI:87919. Add2.

Phylogenomic databases

eggNOGiKOG3699. Eukaryota.
COG0235. LUCA.
GeneTreeiENSGT00390000016462.
HOVERGENiHBG004180.
InParanoidiQ9QYB8.
KOiK18622.
OMAiYKIFHLQ.
OrthoDBiEOG091G0324.
PhylomeDBiQ9QYB8.
TreeFamiTF313003.

Enzyme and pathway databases

ReactomeiR-MMU-5223345. Miscellaneous transport and binding events.

Miscellaneous databases

PROiQ9QYB8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030000.
CleanExiMM_ADD2.
ExpressionAtlasiQ9QYB8. baseline and differential.
GenevisibleiQ9QYB8. MM.

Family and domain databases

Gene3Di3.40.225.10. 1 hit.
InterProiIPR027773. ADD2.
IPR001303. Aldolase_II/adducin_N.
[Graphical view]
PANTHERiPTHR10672:SF6. PTHR10672:SF6. 1 hit.
PfamiPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTiSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMiSSF53639. SSF53639. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiADDB_MOUSE
AccessioniPrimary (citable) accession number: Q9QYB8
Secondary accession number(s): Q3U0E1
, Q80VH9, Q8C1C4, Q9CXE3, Q9JLE4, Q9JLE5, Q9QYB7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: November 2, 2016
This is version 140 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.