Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QYB8

- ADDB_MOUSE

UniProt

Q9QYB8 - ADDB_MOUSE

Protein

Beta-adducin

Gene

Add2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 4 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit By similarity.By similarity

    GO - Molecular functioni

    1. structural molecule activity Source: MGI

    GO - Biological processi

    1. actin filament bundle assembly Source: Ensembl
    2. barbed-end actin filament capping Source: Ensembl
    3. hemopoiesis Source: MGI
    4. positive regulation of protein binding Source: Ensembl
    5. protein complex assembly Source: UniProtKB

    Keywords - Ligandi

    Actin-binding, Calmodulin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Beta-adducin
    Alternative name(s):
    Add97
    Erythrocyte adducin subunit beta
    Gene namesi
    Name:Add2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 6

    Organism-specific databases

    MGIiMGI:87919. Add2.

    Subcellular locationi

    Cytoplasmcytoskeleton By similarity. Cell membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity

    GO - Cellular componenti

    1. cytoplasmic membrane-bounded vesicle Source: UniProtKB
    2. F-actin capping protein complex Source: Ensembl
    3. membrane Source: MGI
    4. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoskeleton, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 725725Beta-adducinPRO_0000218534Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei55 – 551PhosphothreonineBy similarity
    Modified residuei530 – 5301PhosphoserineBy similarity
    Modified residuei532 – 5321Phosphoserine1 Publication
    Modified residuei535 – 5351Phosphoserine1 Publication
    Modified residuei561 – 5611Phosphothreonine
    Modified residuei594 – 5941PhosphoserineBy similarity
    Modified residuei598 – 5981PhosphoserineBy similarity
    Modified residuei602 – 6021Phosphoserine1 Publication
    Modified residuei606 – 6061PhosphoserineBy similarity
    Modified residuei612 – 6121PhosphothreonineBy similarity
    Modified residuei614 – 6141PhosphoserineBy similarity
    Modified residuei618 – 6181PhosphoserineBy similarity
    Modified residuei692 – 6921PhosphoserineBy similarity
    Modified residuei696 – 6961PhosphoserineBy similarity
    Modified residuei702 – 7021PhosphoserineBy similarity
    Modified residuei712 – 7121PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9QYB8.
    PaxDbiQ9QYB8.
    PRIDEiQ9QYB8.

    2D gel databases

    REPRODUCTION-2DPAGEQ9QYB8.

    PTM databases

    PhosphoSiteiQ9QYB8.

    Expressioni

    Gene expression databases

    BgeeiQ9QYB8.
    CleanExiMM_ADD2.
    GenevestigatoriQ9QYB8.

    Interactioni

    Subunit structurei

    Found in a complex with ADD2, DMTN and SLC2A1. Interacts with SLC2A1 By similarity. Heterodimer of an alpha and a beta subunit.By similarity

    Protein-protein interaction databases

    BioGridi197982. 1 interaction.
    IntActiQ9QYB8. 3 interactions.
    MINTiMINT-4998363.
    STRINGi10090.ENSMUSP00000032069.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QYB8.
    SMRiQ9QYB8. Positions 149-327.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni425 – 44420Interaction with calmodulinSequence AnalysisAdd
    BLAST
    Regioni703 – 72018Interaction with calmodulinSequence AnalysisAdd
    BLAST

    Domaini

    Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG0235.
    GeneTreeiENSGT00390000016462.
    HOVERGENiHBG004180.
    InParanoidiQ9QYB8.
    OMAiSGPMSPE.
    OrthoDBiEOG7HF1HR.
    PhylomeDBiQ9QYB8.
    TreeFamiTF313003.

    Family and domain databases

    Gene3Di3.40.225.10. 1 hit.
    InterProiIPR027773. ADD2.
    IPR001303. Aldolase_II/adducin_N.
    [Graphical view]
    PANTHERiPTHR10672:SF6. PTHR10672:SF6. 1 hit.
    PfamiPF00596. Aldolase_II. 1 hit.
    [Graphical view]
    SMARTiSM01007. Aldolase_II. 1 hit.
    [Graphical view]
    SUPFAMiSSF53639. SSF53639. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9QYB8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ    50
    KKRVTMILQS PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA 100
    VFPASSMNFS MMTPINDLHT ADSLNLAKGE RLMRCKISSV YRLLDLYGWA 150
    QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV TASSLIKVNI LGEVVEKGSS 200
    CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK CGLLPVSHNA 250
    LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE 300
    EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS 350
    TFGPMQKSRL GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI 400
    PATVTAFVFE EDGVPVPALR QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ 450
    RNMGSPRPKT TWMKADEVEK SSSGMPIRIE NPNQFVPLYT DPQEVLDMRN 500
    KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLMSK GDADTKDESE 550
    ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDIATE KPGSPVKSTP 600
    ASPVQSPSKA GTKSPAVSPS KTSEDTKKTE VSEANTEPEP VKPEGLVVNG 650
    KEEEPSVEEA LSKGLGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS 700
    PSKKKKKFRT PSFLKKSKKK EKVES 725
    Length:725
    Mass (Da):80,642
    Last modified:January 23, 2007 - v4
    Checksum:i479153AB1BD6C0DA
    GO
    Isoform 2 (identifier: Q9QYB8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         532-562: STESQLMSKGDADTKDESEETVPNPFSQLTD → VQQRLPPTEGEVYQTPGAGQGTPESSGPLTP
         563-725: Missing.

    Note: Contains a phosphothreonine at position 561.

    Show »
    Length:562
    Mass (Da):62,816
    Checksum:iAECF298E23B44CB8
    GO
    Isoform 3 (identifier: Q9QYB8-3) [UniParc]FASTAAdd to Basket

    Also known as: Delta

    The sequence of this isoform differs from the canonical sequence as follows:
         284-531: Missing.

    Show »
    Length:477
    Mass (Da):52,522
    Checksum:iA15E5687AFD48EF0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti219 – 2191R → T in AAF29503. (PubMed:10845937)Curated
    Sequence conflicti469 – 4691E → Q in AAF24972. (PubMed:10602987)Curated
    Sequence conflicti469 – 4691E → Q in AAF24973. (PubMed:10602987)Curated
    Sequence conflicti518 – 5181Q → H in BAC25943. (PubMed:16141072)Curated
    Sequence conflicti634 – 6341A → R in AAF24972. (PubMed:10602987)Curated
    Sequence conflicti666 – 6661G → V in AAF24972. (PubMed:10602987)Curated
    Sequence conflicti675 – 6751D → V in AAF29502. (PubMed:10845937)Curated
    Sequence conflicti675 – 6751D → V in AAF29503. (PubMed:10845937)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei284 – 531248Missing in isoform 3. 1 PublicationVSP_022596Add
    BLAST
    Alternative sequencei532 – 56231STESQ…SQLTD → VQQRLPPTEGEVYQTPGAGQ GTPESSGPLTP in isoform 2. 2 PublicationsVSP_000184Add
    BLAST
    Alternative sequencei563 – 725163Missing in isoform 2. 2 PublicationsVSP_000185Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF100422 mRNA. Translation: AAF24972.1.
    AF100423 mRNA. Translation: AAF24973.1.
    AF189769 mRNA. Translation: AAF29502.1.
    AF189770 mRNA. Translation: AAF29503.1.
    AK014496 mRNA. Translation: BAB29395.1.
    AK028425 mRNA. Translation: BAC25943.1.
    AK156954 mRNA. Translation: BAE33913.1.
    BC046783 mRNA. Translation: AAH46783.1.
    BC053032 mRNA. Translation: AAH53032.1.
    CCDSiCCDS20308.1. [Q9QYB8-1]
    PIRiA60670.
    RefSeqiNP_001258786.1. NM_001271857.1. [Q9QYB8-1]
    NP_001258787.1. NM_001271858.1. [Q9QYB8-1]
    NP_001258788.1. NM_001271859.1. [Q9QYB8-1]
    NP_001258789.1. NM_001271860.1. [Q9QYB8-2]
    NP_001258790.1. NM_001271861.1. [Q9QYB8-2]
    NP_038486.2. NM_013458.5. [Q9QYB8-1]
    UniGeneiMm.104155.
    Mm.489430.

    Genome annotation databases

    EnsembliENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000. [Q9QYB8-1]
    GeneIDi11519.
    KEGGimmu:11519.
    UCSCiuc009crd.1. mouse. [Q9QYB8-2]
    uc009cre.1. mouse. [Q9QYB8-1]
    uc012eoj.1. mouse. [Q9QYB8-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF100422 mRNA. Translation: AAF24972.1 .
    AF100423 mRNA. Translation: AAF24973.1 .
    AF189769 mRNA. Translation: AAF29502.1 .
    AF189770 mRNA. Translation: AAF29503.1 .
    AK014496 mRNA. Translation: BAB29395.1 .
    AK028425 mRNA. Translation: BAC25943.1 .
    AK156954 mRNA. Translation: BAE33913.1 .
    BC046783 mRNA. Translation: AAH46783.1 .
    BC053032 mRNA. Translation: AAH53032.1 .
    CCDSi CCDS20308.1. [Q9QYB8-1 ]
    PIRi A60670.
    RefSeqi NP_001258786.1. NM_001271857.1. [Q9QYB8-1 ]
    NP_001258787.1. NM_001271858.1. [Q9QYB8-1 ]
    NP_001258788.1. NM_001271859.1. [Q9QYB8-1 ]
    NP_001258789.1. NM_001271860.1. [Q9QYB8-2 ]
    NP_001258790.1. NM_001271861.1. [Q9QYB8-2 ]
    NP_038486.2. NM_013458.5. [Q9QYB8-1 ]
    UniGenei Mm.104155.
    Mm.489430.

    3D structure databases

    ProteinModelPortali Q9QYB8.
    SMRi Q9QYB8. Positions 149-327.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 197982. 1 interaction.
    IntActi Q9QYB8. 3 interactions.
    MINTi MINT-4998363.
    STRINGi 10090.ENSMUSP00000032069.

    PTM databases

    PhosphoSitei Q9QYB8.

    2D gel databases

    REPRODUCTION-2DPAGE Q9QYB8.

    Proteomic databases

    MaxQBi Q9QYB8.
    PaxDbi Q9QYB8.
    PRIDEi Q9QYB8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000032069 ; ENSMUSP00000032069 ; ENSMUSG00000030000 . [Q9QYB8-1 ]
    GeneIDi 11519.
    KEGGi mmu:11519.
    UCSCi uc009crd.1. mouse. [Q9QYB8-2 ]
    uc009cre.1. mouse. [Q9QYB8-1 ]
    uc012eoj.1. mouse. [Q9QYB8-3 ]

    Organism-specific databases

    CTDi 119.
    MGIi MGI:87919. Add2.

    Phylogenomic databases

    eggNOGi COG0235.
    GeneTreei ENSGT00390000016462.
    HOVERGENi HBG004180.
    InParanoidi Q9QYB8.
    OMAi SGPMSPE.
    OrthoDBi EOG7HF1HR.
    PhylomeDBi Q9QYB8.
    TreeFami TF313003.

    Miscellaneous databases

    NextBioi 278952.
    PROi Q9QYB8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9QYB8.
    CleanExi MM_ADD2.
    Genevestigatori Q9QYB8.

    Family and domain databases

    Gene3Di 3.40.225.10. 1 hit.
    InterProi IPR027773. ADD2.
    IPR001303. Aldolase_II/adducin_N.
    [Graphical view ]
    PANTHERi PTHR10672:SF6. PTHR10672:SF6. 1 hit.
    Pfami PF00596. Aldolase_II. 1 hit.
    [Graphical view ]
    SMARTi SM01007. Aldolase_II. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53639. SSF53639. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The mouse adducin gene family: alternative splicing and chromosomal localization."
      Suriyapperuma S.P., Lozovatsky L., Ciciotte S.L., Peters L.L., Gilligan D.M.
      Mamm. Genome 11:16-23(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
    2. "Mild spherocytic hereditary elliptocytosis and altered levels of alpha- and gamma-adducins in beta-adducin-deficient mice."
      Muro A.F., Marro M.L., Gajovic S., Porro F., Luzzatto L., Baralle F.E.
      Blood 95:3978-3985(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
      Strain: C57BL/6.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: C57BL/6J and NOD.
      Tissue: Embryonic liver and Spleen.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6.
      Tissue: Embryonic brain.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-561 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic brain.
    6. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    7. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
      Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
      Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain cortex.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-532 AND SER-535, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiADDB_MOUSE
    AccessioniPrimary (citable) accession number: Q9QYB8
    Secondary accession number(s): Q3U0E1
    , Q80VH9, Q8C1C4, Q9CXE3, Q9JLE4, Q9JLE5, Q9QYB7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 120 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3