Q9QYB8 (ADDB_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Beta-adducin Alternative name(s): Add97 Erythrocyte adducin subunit beta | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 725 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit By similarity. |
| Subunit structure | Heterodimer of an alpha and a beta subunit. |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity. |
| Domain | Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region. |
| Sequence similarities | Belongs to the aldolase class II family. Adducin subfamily. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9QYB8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9QYB8-2) The sequence of this isoform differs from the canonical sequence as follows: 532-562: STESQLMSKGDADTKDESEETVPNPFSQLTD → VQQRLPPTEGEVYQTPGAGQGTPESSGPLTP 563-725: Missing. | ||||||
| Note: Contains a phosphothreonine at position 561. | ||||||
| Isoform 3 (identifier: Q9QYB8-3) Also known as: Delta; The sequence of this isoform differs from the canonical sequence as follows: 284-531: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||
| Chain | 2 – 725 | 724 | Beta-adducin | PRO_0000218534 | |||||
Regions | |||||||||
| Region | 425 – 444 | 20 | Interaction with calmodulin Potential | ||||||
| Region | 703 – 720 | 18 | Interaction with calmodulin Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.6 | ||||||
| Modified residue | 55 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 530 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 532 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 535 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 561 | 1 | Phosphothreonine Ref.5 | ||||||
| Modified residue | 594 | 1 | Phosphoserine Ref.6 Ref.9 | ||||||
| Modified residue | 598 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 602 | 1 | Phosphoserine Ref.6 Ref.7 | ||||||
| Modified residue | 606 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 612 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 614 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 618 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 687 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 692 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 696 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 702 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 712 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 284 – 531 | 248 | Missing in isoform 3. | VSP_022596 | |||||
| Alternative sequence | 532 – 562 | 31 | STESQ…SQLTD → VQQRLPPTEGEVYQTPGAGQ GTPESSGPLTP in isoform 2. | VSP_000184 | |||||
| Alternative sequence | 563 – 725 | 163 | Missing in isoform 2. | VSP_000185 | |||||
Experimental info | |||||||||
| Sequence conflict | 219 | 1 | R → T in AAF29503. Ref.2 | ||||||
| Sequence conflict | 469 | 1 | E → Q in AAF24972. Ref.1 | ||||||
| Sequence conflict | 469 | 1 | E → Q in AAF24973. Ref.1 | ||||||
| Sequence conflict | 518 | 1 | Q → H in BAC25943. Ref.3 | ||||||
| Sequence conflict | 634 | 1 | A → R in AAF24972. Ref.1 | ||||||
| Sequence conflict | 666 | 1 | G → V in AAF24972. Ref.1 | ||||||
| Sequence conflict | 675 | 1 | D → V in AAF29502. Ref.2 | ||||||
| Sequence conflict | 675 | 1 | D → V in AAF29503. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The mouse adducin gene family: alternative splicing and chromosomal localization." Suriyapperuma S.P., Lozovatsky L., Ciciotte S.L., Peters L.L., Gilligan D.M. Mamm. Genome 11:16-23(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [2] | "Mild spherocytic hereditary elliptocytosis and altered levels of alpha- and gamma-adducins in beta-adducin-deficient mice." Muro A.F., Marro M.L., Gajovic S., Porro F., Luzzatto L., Baralle F.E. Blood 95:3978-3985(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3). Strain: C57BL/6. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J and NOD. Tissue: Embryonic liver and Spleen. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Embryonic brain. |
| [5] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-561 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Embryonic brain. |
| [6] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, PHOSPHORYLATION AT SER-594 AND SER-602, MASS SPECTROMETRY. Tissue: Brain. |
| [7] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-602 AND THR-687, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [8] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-532 AND SER-535, MASS SPECTROMETRY. Tissue: Liver. |
| [9] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-594, MASS SPECTROMETRY. Tissue: Melanoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF100422 mRNA. Translation: AAF24972.1. AF100423 mRNA. Translation: AAF24973.1. AF189769 mRNA. Translation: AAF29502.1. AF189770 mRNA. Translation: AAF29503.1. AK014496 mRNA. Translation: BAB29395.1. AK028425 mRNA. Translation: BAC25943.1. AK156954 mRNA. Translation: BAE33913.1. BC046783 mRNA. Translation: AAH46783.1. BC053032 mRNA. Translation: AAH53032.1. |
| IPI | IPI00311962. IPI00323122. IPI00400328. |
| PIR | A60670. |
| RefSeq | NP_001258786.1. NM_001271857.1. NP_001258787.1. NM_001271858.1. NP_001258788.1. NM_001271859.1. NP_001258789.1. NM_001271860.1. NP_001258790.1. NM_001271861.1. NP_038486.2. NM_013458.5. |
| UniGene | Mm.104155. |
3D structure databases | |
| ProteinModelPortal | Q9QYB8. |
| SMR | Q9QYB8. Positions 149-327. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9QYB8. 1 interaction. |
| STRING | 10090.ENSMUSP00000032069. |
PTM databases | |
| PhosphoSite | Q9QYB8. |
2D gel databases | |
| REPRODUCTION-2DPAGE | Q9QYB8. |
Proteomic databases | |
| PaxDb | Q9QYB8. |
| PRIDE | Q9QYB8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000. |
| GeneID | 11519. |
| KEGG | mmu:11519. |
| UCSC | uc009crd.1. mouse. uc009cre.1. mouse. uc012eoj.1. mouse. |
Organism-specific databases | |
| CTD | 119. |
| MGI | MGI:87919. Add2. |
Phylogenomic databases | |
| eggNOG | COG0235. |
| GeneTree | ENSGT00390000016462. |
| HOVERGEN | HBG004180. |
| InParanoid | Q9QYB8. |
| OMA | SGPMSPE. |
| OrthoDB | EOG4894M8. |
Gene expression databases | |
| Bgee | Q9QYB8. |
| CleanEx | MM_ADD2. |
| Genevestigator | Q9QYB8. |
| GermOnline | ENSMUSG00000030000. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.40.225.10. 1 hit. |
| InterPro | IPR001303. Aldolase_II/adducin_N. [Graphical view] |
| Pfam | PF00596. Aldolase_II. 1 hit. [Graphical view] |
| SMART | SM01007. Aldolase_II. 1 hit. [Graphical view] |
| SUPFAM | SSF53639. Aldolase_II_N. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 278952. |
| SOURCE | Search... |
Entry information
| Entry name | ADDB_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QYB8 Secondary accession number(s): Q3U0E1 Q9QYB7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
