Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QYB8 (ADDB_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Beta-adducin
Alternative name(s):
Add97
Erythrocyte adducin subunit beta
Gene names
Name:Add2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length725 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit By similarity.

Subunit structure

Found in a complex with ADD2, DMTN and SLC2A1. Interacts with SLC2A1 By similarity. Heterodimer of an alpha and a beta subunit.

Subcellular location

Cytoplasmcytoskeleton By similarity. Cell membrane; Peripheral membrane protein; Cytoplasmic side By similarity.

Domain

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

Sequence similarities

Belongs to the aldolase class II family. Adducin subfamily.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9QYB8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9QYB8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     532-562: STESQLMSKGDADTKDESEETVPNPFSQLTD → VQQRLPPTEGEVYQTPGAGQGTPESSGPLTP
     563-725: Missing.
Note: Contains a phosphothreonine at position 561.
Isoform 3 (identifier: Q9QYB8-3)

Also known as: Delta;

The sequence of this isoform differs from the canonical sequence as follows:
     284-531: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 725725Beta-adducin
PRO_0000218534

Regions

Region425 – 44420Interaction with calmodulin Potential
Region703 – 72018Interaction with calmodulin Potential

Amino acid modifications

Modified residue551Phosphothreonine By similarity
Modified residue5301Phosphoserine By similarity
Modified residue5321Phosphoserine Ref.8
Modified residue5351Phosphoserine Ref.8
Modified residue5611Phosphothreonine Ref.5
Modified residue5941Phosphoserine By similarity
Modified residue5981Phosphoserine By similarity
Modified residue6021Phosphoserine Ref.6
Modified residue6061Phosphoserine By similarity
Modified residue6121Phosphothreonine By similarity
Modified residue6141Phosphoserine By similarity
Modified residue6181Phosphoserine By similarity
Modified residue6921Phosphoserine By similarity
Modified residue6961Phosphoserine By similarity
Modified residue7021Phosphoserine By similarity
Modified residue7121Phosphoserine By similarity

Natural variations

Alternative sequence284 – 531248Missing in isoform 3.
VSP_022596
Alternative sequence532 – 56231STESQ…SQLTD → VQQRLPPTEGEVYQTPGAGQ GTPESSGPLTP in isoform 2.
VSP_000184
Alternative sequence563 – 725163Missing in isoform 2.
VSP_000185

Experimental info

Sequence conflict2191R → T in AAF29503. Ref.2
Sequence conflict4691E → Q in AAF24972. Ref.1
Sequence conflict4691E → Q in AAF24973. Ref.1
Sequence conflict5181Q → H in BAC25943. Ref.3
Sequence conflict6341A → R in AAF24972. Ref.1
Sequence conflict6661G → V in AAF24972. Ref.1
Sequence conflict6751D → V in AAF29502. Ref.2
Sequence conflict6751D → V in AAF29503. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 23, 2007. Version 4.
Checksum: 479153AB1BD6C0DA

FASTA72580,642
        10         20         30         40         50         60 
MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ KKRVTMILQS 

        70         80         90        100        110        120 
PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA VFPASSMNFS MMTPINDLHT 

       130        140        150        160        170        180 
ADSLNLAKGE RLMRCKISSV YRLLDLYGWA QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV 

       190        200        210        220        230        240 
TASSLIKVNI LGEVVEKGSS CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK 

       250        260        270        280        290        300 
CGLLPVSHNA LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE 

       310        320        330        340        350        360 
EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS TFGPMQKSRL 

       370        380        390        400        410        420 
GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI PATVTAFVFE EDGVPVPALR 

       430        440        450        460        470        480 
QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ RNMGSPRPKT TWMKADEVEK SSSGMPIRIE 

       490        500        510        520        530        540 
NPNQFVPLYT DPQEVLDMRN KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLMSK 

       550        560        570        580        590        600 
GDADTKDESE ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDIATE KPGSPVKSTP 

       610        620        630        640        650        660 
ASPVQSPSKA GTKSPAVSPS KTSEDTKKTE VSEANTEPEP VKPEGLVVNG KEEEPSVEEA 

       670        680        690        700        710        720 
LSKGLGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS PSKKKKKFRT PSFLKKSKKK 


EKVES 

« Hide

Isoform 2 [UniParc].

Checksum: AECF298E23B44CB8
Show »

FASTA56262,816
Isoform 3 (Delta) [UniParc].

Checksum: A15E5687AFD48EF0
Show »

FASTA47752,522

References

« Hide 'large scale' references
[1]"The mouse adducin gene family: alternative splicing and chromosomal localization."
Suriyapperuma S.P., Lozovatsky L., Ciciotte S.L., Peters L.L., Gilligan D.M.
Mamm. Genome 11:16-23(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
[2]"Mild spherocytic hereditary elliptocytosis and altered levels of alpha- and gamma-adducins in beta-adducin-deficient mice."
Muro A.F., Marro M.L., Gajovic S., Porro F., Luzzatto L., Baralle F.E.
Blood 95:3978-3985(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
Strain: C57BL/6.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Strain: C57BL/6J and NOD.
Tissue: Embryonic liver and Spleen.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6.
Tissue: Embryonic brain.
[5]"Phosphoproteomic analysis of the developing mouse brain."
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.
Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-561 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic brain.
[6]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-602, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[7]"Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain cortex.
[8]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-532 AND SER-535, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF100422 mRNA. Translation: AAF24972.1.
AF100423 mRNA. Translation: AAF24973.1.
AF189769 mRNA. Translation: AAF29502.1.
AF189770 mRNA. Translation: AAF29503.1.
AK014496 mRNA. Translation: BAB29395.1.
AK028425 mRNA. Translation: BAC25943.1.
AK156954 mRNA. Translation: BAE33913.1.
BC046783 mRNA. Translation: AAH46783.1.
BC053032 mRNA. Translation: AAH53032.1.
PIRA60670.
RefSeqNP_001258786.1. NM_001271857.1.
NP_001258787.1. NM_001271858.1.
NP_001258788.1. NM_001271859.1.
NP_001258789.1. NM_001271860.1.
NP_001258790.1. NM_001271861.1.
NP_038486.2. NM_013458.5.
UniGeneMm.104155.
Mm.489430.

3D structure databases

ProteinModelPortalQ9QYB8.
SMRQ9QYB8. Positions 120-385.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid197982. 1 interaction.
IntActQ9QYB8. 3 interactions.
MINTMINT-4998363.
STRING10090.ENSMUSP00000032069.

PTM databases

PhosphoSiteQ9QYB8.

2D gel databases

REPRODUCTION-2DPAGEQ9QYB8.

Proteomic databases

PaxDbQ9QYB8.
PRIDEQ9QYB8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000. [Q9QYB8-1]
GeneID11519.
KEGGmmu:11519.
UCSCuc009crd.1. mouse. [Q9QYB8-2]
uc009cre.1. mouse. [Q9QYB8-1]
uc012eoj.1. mouse. [Q9QYB8-3]

Organism-specific databases

CTD119.
MGIMGI:87919. Add2.

Phylogenomic databases

eggNOGCOG0235.
GeneTreeENSGT00390000016462.
HOVERGENHBG004180.
InParanoidQ9QYB8.
OMASGPMSPE.
OrthoDBEOG7HF1HR.
PhylomeDBQ9QYB8.
TreeFamTF313003.

Gene expression databases

BgeeQ9QYB8.
CleanExMM_ADD2.
GenevestigatorQ9QYB8.

Family and domain databases

Gene3D3.40.225.10. 1 hit.
InterProIPR027773. ADD2.
IPR001303. Aldolase_II/adducin_N.
[Graphical view]
PANTHERPTHR10672:SF6. PTHR10672:SF6. 1 hit.
PfamPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMSSF53639. SSF53639. 1 hit.
ProtoNetSearch...

Other

NextBio278952.
PROQ9QYB8.
SOURCESearch...

Entry information

Entry nameADDB_MOUSE
AccessionPrimary (citable) accession number: Q9QYB8
Secondary accession number(s): Q3U0E1 expand/collapse secondary AC list , Q80VH9, Q8C1C4, Q9CXE3, Q9JLE4, Q9JLE5, Q9QYB7
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: April 16, 2014
This is version 116 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot