Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-adducin

Gene

Add2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Binds to the erythrocyte membrane receptor SLC2A1/GLUT1 and may therefore provide a link between the spectrin cytoskeleton to the plasma membrane. Binds to calmodulin. Calmodulin binds preferentially to the beta subunit (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin-binding, Calmodulin-binding

Enzyme and pathway databases

ReactomeiR-MMU-5223345 Miscellaneous transport and binding events

Names & Taxonomyi

Protein namesi
Recommended name:
Beta-adducin
Alternative name(s):
Add97
Erythrocyte adducin subunit beta
Gene namesi
Name:Add2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:87919 Add2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002185341 – 725Beta-adducinAdd BLAST725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei11PhosphoserineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei55PhosphothreonineBy similarity1
Modified residuei60PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei532PhosphoserineCombined sources1
Modified residuei533PhosphothreonineCombined sources1
Modified residuei535PhosphoserineCombined sources1
Modified residuei594PhosphoserineCombined sources1
Modified residuei598PhosphoserineCombined sources1
Modified residuei602PhosphoserineCombined sources1
Modified residuei606PhosphoserineCombined sources1
Modified residuei612PhosphothreonineBy similarity1
Modified residuei614PhosphoserineCombined sources1
Modified residuei618PhosphoserineCombined sources1
Modified residuei620PhosphoserineCombined sources1
Modified residuei674PhosphothreonineBy similarity1
Modified residuei678PhosphoserineBy similarity1
Modified residuei685PhosphoserineBy similarity1
Modified residuei688PhosphoserineCombined sources1
Modified residuei692PhosphoserineCombined sources1
Modified residuei696PhosphoserineCombined sources1
Modified residuei698PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1
Modified residuei702PhosphoserineBy similarity1
Modified residuei712PhosphoserineBy similarity1
Isoform 2 (identifier: Q9QYB8-2)
Modified residuei561PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9QYB8
PaxDbiQ9QYB8
PeptideAtlasiQ9QYB8
PRIDEiQ9QYB8

2D gel databases

REPRODUCTION-2DPAGEiQ9QYB8

PTM databases

iPTMnetiQ9QYB8
PhosphoSitePlusiQ9QYB8

Expressioni

Gene expression databases

BgeeiENSMUSG00000030000
CleanExiMM_ADD2
ExpressionAtlasiQ9QYB8 baseline and differential
GenevisibleiQ9QYB8 MM

Interactioni

Subunit structurei

Found in a complex with ADD2, DMTN and SLC2A1. Interacts with SLC2A1 (By similarity). Heterodimer of an alpha and a beta subunit.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi197982, 1 interactor
IntActiQ9QYB8, 3 interactors
MINTiQ9QYB8
STRINGi10090.ENSMUSP00000032069

Structurei

3D structure databases

ProteinModelPortaliQ9QYB8
SMRiQ9QYB8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni425 – 444Interaction with calmodulinSequence analysisAdd BLAST20
Regioni703 – 720Interaction with calmodulinSequence analysisAdd BLAST18

Domaini

Each subunit is comprised of three regions: a NH2-terminal protease-resistant globular head region, a short connecting subdomain, and a protease-sensitive tail region.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3699 Eukaryota
COG0235 LUCA
GeneTreeiENSGT00390000016462
HOVERGENiHBG004180
InParanoidiQ9QYB8
KOiK18622
OMAiDHFLISP
OrthoDBiEOG091G0324
PhylomeDBiQ9QYB8
TreeFamiTF313003

Family and domain databases

Gene3Di3.40.225.10, 1 hit
InterProiView protein in InterPro
IPR027773 ADD2
IPR001303 Aldolase_II/adducin_N
IPR036409 Aldolase_II/adducin_N_sf
PANTHERiPTHR10672:SF6 PTHR10672:SF6, 1 hit
PfamiView protein in Pfam
PF00596 Aldolase_II, 1 hit
SMARTiView protein in SMART
SM01007 Aldolase_II, 1 hit
SUPFAMiSSF53639 SSF53639, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9QYB8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEDTVPEAA SPPPSQGQHY FDRFSEDDPE YLRLRNRAAD LRQDFNLMEQ
60 70 80 90 100
KKRVTMILQS PSFREELEGL IQEQMKKGNN SSNIWALRQI ADFMASTSHA
110 120 130 140 150
VFPASSMNFS MMTPINDLHT ADSLNLAKGE RLMRCKISSV YRLLDLYGWA
160 170 180 190 200
QLSDTYVTLR VSKEQDHFLI SPKGVSCSEV TASSLIKVNI LGEVVEKGSS
210 220 230 240 250
CFPVDTTGFS LHSAIYAARP DVRCAIHLHT PATAAVSAMK CGLLPVSHNA
260 270 280 290 300
LLVGDMAYYD FNGEMEQEAD RINLQKCLGP TCKILVLRNH GMVALGDTVE
310 320 330 340 350
EAFYKVFHLQ AACEVQVSAL SSAGGTENLI LLEQEKHRPH EVGSVQWAGS
360 370 380 390 400
TFGPMQKSRL GEHEFEALMR MLDNLGYRTG YTYRHPFVQE KTKHKSEVEI
410 420 430 440 450
PATVTAFVFE EDGVPVPALR QHAQKQQKEK TRWLNTPNTY LRVNVADEVQ
460 470 480 490 500
RNMGSPRPKT TWMKADEVEK SSSGMPIRIE NPNQFVPLYT DPQEVLDMRN
510 520 530 540 550
KIREQNRQDI KSAGPQSQLL ASVIAEKSRS PSTESQLMSK GDADTKDESE
560 570 580 590 600
ETVPNPFSQL TDQELEEYKK EVERKKLEQE QEGEKDIATE KPGSPVKSTP
610 620 630 640 650
ASPVQSPSKA GTKSPAVSPS KTSEDTKKTE VSEANTEPEP VKPEGLVVNG
660 670 680 690 700
KEEEPSVEEA LSKGLGQMTT NADTDGDSYK DKTESVTSGP LSPEGSPSKS
710 720
PSKKKKKFRT PSFLKKSKKK EKVES
Length:725
Mass (Da):80,642
Last modified:January 23, 2007 - v4
Checksum:i479153AB1BD6C0DA
GO
Isoform 2 (identifier: Q9QYB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     532-562: STESQLMSKGDADTKDESEETVPNPFSQLTD → VQQRLPPTEGEVYQTPGAGQGTPESSGPLTP
     563-725: Missing.

Show »
Length:562
Mass (Da):62,816
Checksum:iAECF298E23B44CB8
GO
Isoform 3 (identifier: Q9QYB8-3) [UniParc]FASTAAdd to basket
Also known as: Delta

The sequence of this isoform differs from the canonical sequence as follows:
     284-531: Missing.

Show »
Length:477
Mass (Da):52,522
Checksum:iA15E5687AFD48EF0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti219R → T in AAF29503 (PubMed:10845937).Curated1
Sequence conflicti469E → Q in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti469E → Q in AAF24973 (PubMed:10602987).Curated1
Sequence conflicti518Q → H in BAC25943 (PubMed:16141072).Curated1
Sequence conflicti634A → R in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti666G → V in AAF24972 (PubMed:10602987).Curated1
Sequence conflicti675D → V in AAF29502 (PubMed:10845937).Curated1
Sequence conflicti675D → V in AAF29503 (PubMed:10845937).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022596284 – 531Missing in isoform 3. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_000184532 – 562STESQ…SQLTD → VQQRLPPTEGEVYQTPGAGQ GTPESSGPLTP in isoform 2. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_000185563 – 725Missing in isoform 2. 2 PublicationsAdd BLAST163

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF100422 mRNA Translation: AAF24972.1
AF100423 mRNA Translation: AAF24973.1
AF189769 mRNA Translation: AAF29502.1
AF189770 mRNA Translation: AAF29503.1
AK014496 mRNA Translation: BAB29395.1
AK028425 mRNA Translation: BAC25943.1
AK156954 mRNA Translation: BAE33913.1
BC046783 mRNA Translation: AAH46783.1
BC053032 mRNA Translation: AAH53032.1
CCDSiCCDS20308.1 [Q9QYB8-1]
CCDS85085.1 [Q9QYB8-2]
PIRiA60670
RefSeqiNP_001258786.1, NM_001271857.1 [Q9QYB8-1]
NP_001258787.1, NM_001271858.1 [Q9QYB8-1]
NP_001258788.1, NM_001271859.1 [Q9QYB8-1]
NP_001258789.1, NM_001271860.1 [Q9QYB8-2]
NP_001258790.1, NM_001271861.1 [Q9QYB8-2]
NP_038486.2, NM_013458.5 [Q9QYB8-1]
UniGeneiMm.104155
Mm.489430

Genome annotation databases

EnsembliENSMUST00000032069; ENSMUSP00000032069; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000203196; ENSMUSP00000145104; ENSMUSG00000030000 [Q9QYB8-2]
ENSMUST00000203279; ENSMUSP00000145452; ENSMUSG00000030000 [Q9QYB8-3]
ENSMUST00000203366; ENSMUSP00000144849; ENSMUSG00000030000 [Q9QYB8-2]
ENSMUST00000203724; ENSMUSP00000145296; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000203786; ENSMUSP00000144694; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000204059; ENSMUSP00000145160; ENSMUSG00000030000 [Q9QYB8-1]
ENSMUST00000205034; ENSMUSP00000145034; ENSMUSG00000030000 [Q9QYB8-2]
GeneIDi11519
KEGGimmu:11519
UCSCiuc009crd.2 mouse [Q9QYB8-2]
uc009cre.2 mouse [Q9QYB8-1]
uc012eoj.2 mouse [Q9QYB8-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiADDB_MOUSE
AccessioniPrimary (citable) accession number: Q9QYB8
Secondary accession number(s): Q3U0E1
, Q80VH9, Q8C1C4, Q9CXE3, Q9JLE4, Q9JLE5, Q9QYB7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: January 23, 2007
Last modified: April 25, 2018
This is version 149 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health