Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QY24 (ZBP1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Z-DNA-binding protein 1
Alternative name(s):
DNA-dependent activator of IFN-regulatory factors
Short name=DAI
Tumor stroma and activated macrophage protein DLM-1
Gene names
Name:Zbp1
Synonyms:Dlm1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length411 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Participates in the detection by the host's innate immune system of DNA from viral, bacterial or even host origin. Plays a role in host defense against tumors and pathogens. Acts as a cytoplasmic DNA sensor which, when activated, induces the recruitment of TBK1 and IRF3 to its C-terminal region and activates the downstream interferon regulatory factor (IRF) and NF-kappa B transcription factors, leading to type-I interferon production. ZBP1-induced NF-kappaB activation probably involves the recruitment of the RHIM containing kinases RIPK1 and RIPK3. Ref.4 Ref.5

Subunit structure

Interacts (via RIP homotypic interaction motif) with murid herpesvirus 1 viral inhibitor of RIP activation (via RIP homotypic interaction motif); this interaction inhibits recruitment of RIPK1 and RIPK3 to ZBP1 and prevents ZBP1-induced NFkappa-B activation. Ref.5

Tissue specificity

Expressed in lung, spleen and liver. Lower levels were seen in heart, kidney and testis. Expression is greatly up-regulated in tumor stromal cells and activated macrophages.

Induction

By interferon gamma and lipopolysaccharides (LPS).

Sequence similarities

Contains 2 DRADA repeats.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9QY24-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9QY24-2)

The sequence of this isoform differs from the canonical sequence as follows:
     154-187: AHSGVTQESPAIICQHNPVNMICQQGANSHISIA → VLPCSPGCPRTHHVDQAGLEPTEIFLLLPIKFWD
     188-411: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 411411Z-DNA-binding protein 1
PRO_0000066565

Regions

Repeat6 – 7267DRADA 1
Repeat82 – 14766DRADA 2
Motif188 – 20518RIP homotypic interaction motif (RHIM) 1
Motif237 – 26125RIP homotypic interaction motif (RHIM) 2

Natural variations

Alternative sequence154 – 18734AHSGV…HISIA → VLPCSPGCPRTHHVDQAGLE PTEIFLLLPIKFWD in isoform 2.
VSP_004083
Alternative sequence188 – 411224Missing in isoform 2.
VSP_004084

Experimental info

Sequence conflict671S → R in AAH20033. Ref.3
Sequence conflict831N → D in AAH20033. Ref.3
Sequence conflict1971G → R in AAH20033. Ref.3
Sequence conflict2931F → S in AAH20033. Ref.3
Sequence conflict4031S → T in AAH20033. Ref.3

Secondary structure

........... 411
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 6D5F7B526A7DAA40

FASTA41144,331
        10         20         30         40         50         60 
MAEAPVDLST GDNLEQKILQ VLSDDGGPVK IGQLVKKCQV PKKTLNQVLY RLKKEDRVSS 

        70         80         90        100        110        120 
PEPATWSIGG AASGDGAPAI PENSSAQPSL DERILRFLEA NGPHRALHIA KALGMTTAKE 

       130        140        150        160        170        180 
VNPLLYSMRN KHLLSYDGQT WKIYHSRQEG QDIAHSGVTQ ESPAIICQHN PVNMICQQGA 

       190        200        210        220        230        240 
NSHISIANSN AIQIGHGNVI VREKACGEPG PRTSHPLPLA WDASAQDMPP VAHGAQYIYM 

       250        260        270        280        290        300 
DKSLLQQVQL GHHNEMSLVG DAGKHPSYSF SDSPPEVSTT TADPGASFNM QTFEPGPHPE 

       310        320        330        340        350        360 
GDTVQTVHIK SCFLEDATIG NGNKMTIHLR SKGEVMESGD SEEPKKEDTG TSSEATPPRS 

       370        380        390        400        410 
CQHTPSDSML PTSELRAMAL GDSSPQTTEP VLREHEVQDI ESSQDTGLSK Q 

« Hide

Isoform 2 [UniParc].

Checksum: 216A1996CDD858DC
Show »

FASTA18720,569

References

« Hide 'large scale' references
[1]"Cloning of DLM-1, a novel gene that is up-regulated in activated macrophages, using RNA differential display."
Fu Y., Comella N., Tognazzi K., Brown L.F., Dvorak H.F., Kocher O.
Gene 240:157-163(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: C3Heb/FeJ.
Tissue: Liver.
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Small intestine.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Mammary tumor.
[4]"DAI (DLM-1/ZBP1) is a cytosolic DNA sensor and an activator of innate immune response."
Takaoka A., Wang Z., Choi M.K., Yanai H., Negishi H., Ban T., Lu Y., Miyagishi M., Kodama T., Honda K., Ohba Y., Taniguchi T.
Nature 448:501-505(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[5]"DAI/ZBP1 recruits RIP1 and RIP3 through RIP homotypic interaction motifs to activate NF-kappaB."
Rebsamen M., Heinz L.X., Meylan E., Michallet M.C., Schroder K., Hofmann K., Vazquez J., Benedict C.A., Tschopp J.
EMBO Rep. 10:916-922(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH RIPK1; RIPK3 AND MURID HERPESVIRUS 1 VIRAL INHIBITOR OF RIP ACTIVATION.
[6]"The phagosomal proteome in interferon-gamma-activated macrophages."
Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Structure of the DLM-1-Z-DNA complex reveals a conserved family of Z-DNA-binding proteins."
Schwartz T., Behlke J., Lowenhaupt K., Heinemann U., Rich A.
Nat. Struct. Biol. 8:761-765(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 8-70, DNA-BINDING.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF136520 mRNA. Translation: AAF17234.1.
AK008179 mRNA. Translation: BAB25513.1.
BC020033 mRNA. Translation: AAH20033.1.
CCDSCCDS17142.1. [Q9QY24-1]
CCDS50813.1. [Q9QY24-2]
RefSeqNP_001132991.1. NM_001139519.1. [Q9QY24-2]
UniGeneMm.116687.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1J75X-ray1.85A8-70[»]
2HEOX-ray1.70A/D8-70[»]
ProteinModelPortalQ9QY24.
SMRQ9QY24. Positions 13-69, 92-144.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

DIPDIP-29879N.
STRING10090.ENSMUSP00000029018.

PTM databases

PhosphoSiteQ9QY24.

Proteomic databases

MaxQBQ9QY24.
PaxDbQ9QY24.
PRIDEQ9QY24.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000109116; ENSMUSP00000104744; ENSMUSG00000027514. [Q9QY24-2]
GeneID58203.
KEGGmmu:58203.

Organism-specific databases

CTD81030.
MGIMGI:1927449. Zbp1.

Phylogenomic databases

eggNOGNOG38978.
GeneTreeENSGT00390000002234.
HOGENOMHOG000230878.
HOVERGENHBG036279.
InParanoidQ9QY24.
KOK12965.
OMAPGCPRTH.
PhylomeDBQ9QY24.

Gene expression databases

ArrayExpressQ9QY24.
BgeeQ9QY24.
CleanExMM_ZBP1.
GenevestigatorQ9QY24.

Family and domain databases

Gene3D1.10.10.10. 2 hits.
InterProIPR000607. dsRNA_A_deaminase.
IPR025735. RHIM_dom.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamPF12721. RHIM. 2 hits.
PF02295. z-alpha. 2 hits.
[Graphical view]
SMARTSM00550. Zalpha. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9QY24.
NextBio314185.
PROQ9QY24.
SOURCESearch...

Entry information

Entry nameZBP1_MOUSE
AccessionPrimary (citable) accession number: Q9QY24
Secondary accession number(s): Q8VE02, Q9D8B9
Entry history
Integrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot