Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/WD repeat-containing protein 5

Gene

Fbxw5

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Substrate recognition component of both SCF (SKP1-CUL1-F-box protein) and DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes. Substrate-specific adapter of the DCX(FBXW5) E3 ubiquitin-protein ligase complex which mediates the polyubiquitination and subsequent degradation of TSC2. May also act as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B (IL1B) signaling pathway. Substrate recognition component of the SCF(FBXW5) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SASS6 during S phase, leading to prevent centriole reduplication (By similarity). The SCF(FBXW5) complex also mediates ubiquitination and degradation of actin-regulator EPS8 during G2 phase, leading to the transient degradation of EPS8 and subsequent cell shape changes required to allow mitotic progression.By similarity1 Publication

Caution

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayiUPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/WD repeat-containing protein 5
Alternative name(s):
F-box and WD-40 domain-containing protein 5
Gene namesi
Name:Fbxw5
Synonyms:Fbw5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1354731 Fbxw5

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000509931 – 573F-box/WD repeat-containing protein 5Add BLAST573

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei151Phosphoserine; by PLK4By similarity1

Post-translational modificationi

Phosphorylated at Ser-151 by PLK4 during the G1/S transition, leading to inhibit its ability to ubiquitinate SASS6.By similarity
Ubiquitinated and degraded by the APC/C complex during mitosis and G1 phase.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ9QXW2
PRIDEiQ9QXW2

PTM databases

iPTMnetiQ9QXW2
PhosphoSitePlusiQ9QXW2

Expressioni

Tissue specificityi

Widely expressed in adult and embryonal tissues.1 Publication

Gene expression databases

BgeeiENSMUSG00000015095
CleanExiMM_FBXW5
ExpressionAtlasiQ9QXW2 baseline and differential
GenevisibleiQ9QXW2 MM

Interactioni

Subunit structurei

Part of the SCF (SKP1-CUL1-F-box) E3 ubiquitin-protein ligase complex SCF(FBXW5) composed of CUL1, SKP1, RBX1 and FBXW5. Component of the DCX(FBXW5) E3 ubiquitin ligase complex, at least composed of (CUL4A or CUL4B), DDB1, FBXW5 and RBX1. Interacts with CDC20, TSC1, TSC2 and SASS6 (By similarity). Interacts with EPS8. Interacts with TNFAIP8L1; TNFAIP8L1 competes with TSC2 to bind FBXW5 increasing TSC2 stability by preventing its ubiquitination.By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Skp1Q9WTX52EBI-16031930,EBI-1202363

GO - Molecular functioni

Protein-protein interaction databases

BioGridi2059764 interactors.
DIPiDIP-60700N
IntActiQ9QXW2 1 interactor.
STRINGi10090.ENSMUSP00000015239

Structurei

3D structure databases

ProteinModelPortaliQ9QXW2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3 – 49F-boxPROSITE-ProRule annotationAdd BLAST47
Repeati90 – 129WD 1Add BLAST40
Repeati470 – 509WD 2Add BLAST40
Repeati511 – 551WD 3Add BLAST41

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi308 – 316D-box9

Domaini

The F-box domain mediates interaction with components of SCF (SKP1-CUL1-F-box protein) complexes, while WD repeats mediate interaction with components of DCX (DDB1-CUL4-X-box) complexes.By similarity
The D-box (destruction box) mediate the interaction with APC proteins, and acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.By similarity

Sequence similaritiesi

Belongs to the FBXW5 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IEAX Eukaryota
ENOG410XTK0 LUCA
GeneTreeiENSGT00730000111276
HOGENOMiHOG000231549
HOVERGENiHBG051595
InParanoidiQ9QXW2
KOiK10263
OMAiPHQIGFK
OrthoDBiEOG091G04E0
TreeFamiTF324320

Family and domain databases

Gene3Di2.130.10.102 hits
InterProiView protein in InterPro
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF12937 F-box-like, 1 hit
PF00400 WD40, 2 hits
SMARTiView protein in SMART
SM00256 FBOX, 1 hit
SM00320 WD40, 3 hits
SUPFAMiSSF50978 SSF50978, 2 hits
SSF81383 SSF81383, 2 hits
PROSITEiView protein in PROSITE
PS50181 FBOX, 1 hit
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QXW2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEGGLPLLP DSLVYQIFLS LGPADVLAAG LVCRQWQAVS RDEFLWKEQF
60 70 80 90 100
YRYYQVARDV PRHPAATSWY EEFRRLYDMV PCVEVQTLKE HTDQVLHLSF
110 120 130 140 150
SHSGYQFASC SKDCTVKIWN NDLTISLLHS ADMRPYNWSY TQFSQFNQDD
160 170 180 190 200
SLLLASGVFL GPHNSSSGEI AVISLDSFAL LSRVRNKPYD VFGCWLTETS
210 220 230 240 250
LISGNLHRIG DITSCSVLWL NNAFQDVESE NVNVVKRLFK IQNLNASTIR
260 270 280 290 300
TVMVADCSRF DSPDLLLDAS DQAGLPCRVF DLGGDTEEEA TDPGLHTSGS
310 320 330 340 350
DHVKKGLRRV FDSVLDGHGQ LSDCALETKV AELLAQGHTK PPECNDADTR
360 370 380 390 400
NKYLIFTTGC LTYSPHQIGI KQILPHQMTT AGPVLGEGRG SDAFFDALDH
410 420 430 440 450
VIDVHGHIIG MGLSPDNRYL YVNSRAWPPG SVVADPMQPP PIAEEIDLLV
460 470 480 490 500
FDLKTMREVK RALRAHRAYT PNDECFFIFL DVSRDFVASG AEDRHGYIWD
510 520 530 540 550
RHYNICLAKL RHEDVVNSVA FSPQEQELLL TASDDATIKA WRSPRIVRVL
560 570
QAPRPRPRPR PRPFFSWFAS HRR
Length:573
Mass (Da):64,646
Last modified:May 1, 2000 - v1
Checksum:iB71B3B207D3091B1
GO
Isoform 2 (identifier: Q9QXW2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSAVEFSGGQLVGLARTAMSGTPDYQSLPGVGDEEAWVQSRHWWVSGPSGQNVTM
     530-573: LTASDDATIK...FFSWFASHRR → PDSQRRCHYQ...PPLLLLVCQP

Note: No experimental confirmation available.
Show »
Length:626
Mass (Da):69,687
Checksum:iA1B30E41EB835282
GO

Sequence cautioni

The sequence CAM25630 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0422931M → MLSAVEFSGGQLVGLARTAM SGTPDYQSLPGVGDEEAWVQ SRHWWVSGPSGQNVTM in isoform 2. 1 Publication1
Alternative sequenceiVSP_042294530 – 573LTASD…ASHRR → PDSQRRCHYQSLAFTTHCSC SAGSTPSPPPSPPPLLLLVC QP in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF176520 mRNA Translation: AAF09130.1
AK019715 mRNA Translation: BAB31841.1
AK154911 mRNA Translation: BAE32921.1
AL732557 Genomic DNA Translation: CAM25629.1
AL732557 Genomic DNA Translation: CAM25630.1 Sequence problems.
CH466542 Genomic DNA Translation: EDL08255.1
BC010776 mRNA Translation: AAH10776.1
CCDSiCCDS15778.1 [Q9QXW2-1]
RefSeqiNP_038936.1, NM_013908.4 [Q9QXW2-1]
UniGeneiMm.29170

Genome annotation databases

EnsembliENSMUST00000015239; ENSMUSP00000015239; ENSMUSG00000015095 [Q9QXW2-1]
GeneIDi30839
KEGGimmu:30839
UCSCiuc008isj.1 mouse [Q9QXW2-1]
uc008isk.1 mouse [Q9QXW2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFBXW5_MOUSE
AccessioniPrimary (citable) accession number: Q9QXW2
Secondary accession number(s): A2AJ36
, A2AJ37, E9QMP0, Q3U368
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2004
Last sequence update: May 1, 2000
Last modified: March 28, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome