Q9QXU7 (PROK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 95.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Prokineticin-2 Short name=PK2 Alternative name(s): Protein Bv8 homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 128 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle By similarity. Ref.3 |
| Subcellular location | |
| Tissue specificity | Expressed in the SCN and among a few other discrete brain areas, including the islands of Calleja, media l preoptic area of the hypothalamus and the shell of the nucleus accumbens. Highly expressed in testis. In the SCN, expression subjected to high amplitude of circadian oscillation. |
| Developmental stage | Expressed in mid-late pachytene spermatocytes at the stages VII, VIII and IX of the semiferous epithelial cycle. |
| Induction | Activated by CLOCK and BMAL1 heterodimers and light; inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2). |
| Sequence similarities | Belongs to the AVIT (prokineticin) family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9QXU7-1) Also known as: Bv8-a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9QXU7-2) Also known as: Bv8-b; The sequence of this isoform differs from the canonical sequence as follows: 74-94: Missing. | ||||||
| Isoform 3 (identifier: Q9QXU7-3) The sequence of this isoform differs from the canonical sequence as follows: 74-128: SHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK → VSVCTGILGVPSH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 26 | 26 | Potential | ||||||||
| Chain | 27 – 128 | 102 | Prokineticin-2 | PRO_0000025810 | |||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 33 ↔ 45 | By similarity | |||||||||
| Disulfide bond | 39 ↔ 57 | By similarity | |||||||||
| Disulfide bond | 44 ↔ 106 | By similarity | |||||||||
| Disulfide bond | 67 ↔ 114 | By similarity | |||||||||
| Disulfide bond | 108 ↔ 124 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 74 – 128 | 55 | SHVAN…CLARK → VSVCTGILGVPSH in isoform 3. | VSP_005221 | |||||||
| Alternative sequence | 74 – 94 | 21 | Missing in isoform 2. | VSP_005220 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The mammalian homologues of frog Bv8 are mainly expressed in spermatocytes." Wechselberger C., Puglisi R., Lepperdinger G., Boitani C., Kreil G. FEBS Lett. 462:177-181(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: 129/Sv. |
| [2] | "Murine Bv8 gene maps near a synteny breakpoint of mouse chromosome 6 and human 3p21." Jilek A., Engel E., Beier D., Lepperdinger G. Gene 256:189-195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3). Strain: 129/SvJ. |
| [3] | "Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus." Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y. Nature 417:405-410(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION. Strain: C57BL/6. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Testis. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF182064 mRNA. Translation: AAF15259.1. AF182065 mRNA. Translation: AAF15260.1. AF182066 mRNA. Translation: AAF15261.1. AF182068, AF182067 Genomic DNA. Translation: AAG09439.1. AF487280 mRNA. Translation: AAM49572.1. AK015462 mRNA. Translation: BAB29857.1. BC144863 mRNA. Translation: AAI44864.1. |
| IPI | IPI00135577. IPI00230605. IPI00230606. |
| RefSeq | NP_001032628.1. NM_001037539.2. NP_056583.1. NM_015768.2. |
| UniGene | Mm.87365. |
3D structure databases | |
| ProteinModelPortal | Q9QXU7. |
| SMR | Q9QXU7. Positions 27-127. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000032152. |
Proteomic databases | |
| PRIDE | Q9QXU7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000032152; ENSMUSP00000032152; ENSMUSG00000030069. ENSMUST00000101120; ENSMUSP00000098678; ENSMUSG00000030069. |
| GeneID | 50501. |
| KEGG | mmu:50501. |
| UCSC | uc009dbu.1. mouse. uc009dbv.1. mouse. |
Organism-specific databases | |
| CTD | 60675. |
| MGI | MGI:1354178. Prok2. |
Phylogenomic databases | |
| eggNOG | NOG39081. |
| GeneTree | ENSGT00390000014799. |
| HOGENOM | HOG000004848. |
| HOVERGEN | HBG031845. |
| InParanoid | Q9QXU7. |
| OMA | PLTRKNH. |
| OrthoDB | EOG42NJ21. |
Gene expression databases | |
| ArrayExpress | Q9QXU7. |
| Bgee | Q9QXU7. |
| CleanEx | MM_PROK2. |
| Genevestigator | Q9QXU7. |
| GermOnline | ENSMUSG00000030069. Mus musculus. |
Family and domain databases | |
| InterPro | IPR009523. Prokineticin. IPR023569. Prokineticin_domain. [Graphical view] |
| PANTHER | PTHR18821. PTHR18821. 1 hit. |
| Pfam | PF06607. Prokineticin. 1 hit. [Graphical view] |
| ProDom | PD059788. Prokineticin. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| ProtoNet | Search... |
Other | |
| NextBio | 307502. |
| SOURCE | Search... |
Entry information
| Entry name | PROK2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QXU7 Secondary accession number(s): B7ZMX7, Q9QXU5, Q9QXU6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
