Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QXU7

- PROK2_MOUSE

UniProt

Q9QXU7 - PROK2_MOUSE

Protein

Prokineticin-2

Gene

Prok2

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
  1. Functioni

    May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle By similarity.By similarity

    GO - Molecular functioni

    1. G-protein coupled receptor binding Source: DFLAT

    GO - Biological processi

    1. angiogenesis Source: UniProtKB
    2. cell proliferation Source: UniProtKB
    3. chemotaxis Source: UniProtKB
    4. circadian rhythm Source: MGI
    5. coronary vasculature development Source: DFLAT
    6. epicardium-derived cardiac endothelial cell differentiation Source: DFLAT
    7. epicardium-derived cardiac vascular smooth muscle cell differentiation Source: DFLAT
    8. negative regulation of apoptotic process Source: UniProtKB
    9. neuropeptide signaling pathway Source: UniProtKB-KW
    10. positive regulation of smooth muscle contraction Source: UniProtKB
    11. spermatogenesis Source: UniProtKB
    12. vasculogenesis involved in coronary vascular morphogenesis Source: DFLAT

    Keywords - Molecular functioni

    Neuropeptide

    Keywords - Biological processi

    Biological rhythms

    Enzyme and pathway databases

    ReactomeiREACT_207651. G alpha (q) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Prokineticin-2
    Short name:
    PK2
    Alternative name(s):
    Protein Bv8 homolog
    Gene namesi
    Name:Prok2
    Synonyms:Bv8
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 6

    Organism-specific databases

    MGIiMGI:1354178. Prok2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2626Sequence AnalysisAdd
    BLAST
    Chaini27 – 128102Prokineticin-2PRO_0000025810Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi33 ↔ 45By similarity
    Disulfide bondi39 ↔ 57By similarity
    Disulfide bondi44 ↔ 106By similarity
    Disulfide bondi67 ↔ 114By similarity
    Disulfide bondi108 ↔ 124By similarity

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PRIDEiQ9QXU7.

    Expressioni

    Tissue specificityi

    Expressed in the SCN and among a few other discrete brain areas, including the islands of Calleja, media l preoptic area of the hypothalamus and the shell of the nucleus accumbens. Highly expressed in testis. In the SCN, expression subjected to high amplitude of circadian oscillation.

    Developmental stagei

    Expressed in mid-late pachytene spermatocytes at the stages VII, VIII and IX of the semiferous epithelial cycle.

    Inductioni

    Activated by CLOCK and BMAL1 heterodimers and light; inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2).

    Gene expression databases

    BgeeiQ9QXU7.
    CleanExiMM_PROK2.
    GenevestigatoriQ9QXU7.

    Interactioni

    Protein-protein interaction databases

    BioGridi206046. 1 interaction.
    STRINGi10090.ENSMUSP00000032152.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QXU7.
    SMRiQ9QXU7. Positions 27-127.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the AVIT (prokineticin) family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG39081.
    GeneTreeiENSGT00390000014799.
    HOGENOMiHOG000004848.
    HOVERGENiHBG031845.
    InParanoidiQ9QXU7.
    OMAiPLTRKNH.
    OrthoDBiEOG7SJD78.
    PhylomeDBiQ9QXU7.
    TreeFamiTF332732.

    Family and domain databases

    InterProiIPR009523. Prokineticin.
    IPR023569. Prokineticin_domain.
    [Graphical view]
    PANTHERiPTHR18821. PTHR18821. 1 hit.
    PfamiPF06607. Prokineticin. 1 hit.
    [Graphical view]
    ProDomiPD059788. Prokineticin. 1 hit.
    [Graphical view] [Entries sharing at least one domain]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9QXU7-1) [UniParc]FASTAAdd to Basket

    Also known as: Bv8-a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGDPRCAPLL LLLLLPLLFT PPAGDAAVIT GACDKDSQCG GGMCCAVSIW    50
    VKSIRICTPM GQVGDSCHPL TRKSHVANGR QERRRAKRRK RKKEVPFWGR 100
    RMHHTCPCLP GLACLRTSFN RFICLARK 128
    Length:128
    Mass (Da):14,185
    Last modified:May 1, 2000 - v1
    Checksum:i5F08BA177FDDB58C
    GO
    Isoform 2 (identifier: Q9QXU7-2) [UniParc]FASTAAdd to Basket

    Also known as: Bv8-b

    The sequence of this isoform differs from the canonical sequence as follows:
         74-94: Missing.

    Show »
    Length:107
    Mass (Da):11,556
    Checksum:i8FB79BE4D4357C70
    GO
    Isoform 3 (identifier: Q9QXU7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         74-128: SHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK → VSVCTGILGVPSH

    Show »
    Length:86
    Mass (Da):8,836
    Checksum:i28EACBC5E6F7706F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei74 – 12855SHVAN…CLARK → VSVCTGILGVPSH in isoform 3. 1 PublicationVSP_005221Add
    BLAST
    Alternative sequencei74 – 9421Missing in isoform 2. 4 PublicationsVSP_005220Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF182064 mRNA. Translation: AAF15259.1.
    AF182065 mRNA. Translation: AAF15260.1.
    AF182066 mRNA. Translation: AAF15261.1.
    AF182068, AF182067 Genomic DNA. Translation: AAG09439.1.
    AF487280 mRNA. Translation: AAM49572.1.
    AK015462 mRNA. Translation: BAB29857.1.
    BC144863 mRNA. Translation: AAI44864.1.
    CCDSiCCDS20388.1. [Q9QXU7-2]
    CCDS20389.1. [Q9QXU7-1]
    RefSeqiNP_001032628.1. NM_001037539.2. [Q9QXU7-2]
    NP_056583.1. NM_015768.2. [Q9QXU7-1]
    UniGeneiMm.87365.

    Genome annotation databases

    EnsembliENSMUST00000032152; ENSMUSP00000032152; ENSMUSG00000030069. [Q9QXU7-1]
    ENSMUST00000101120; ENSMUSP00000098678; ENSMUSG00000030069. [Q9QXU7-2]
    GeneIDi50501.
    KEGGimmu:50501.
    UCSCiuc009dbt.1. mouse. [Q9QXU7-1]
    uc009dbu.1. mouse. [Q9QXU7-2]
    uc009dbv.1. mouse. [Q9QXU7-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF182064 mRNA. Translation: AAF15259.1 .
    AF182065 mRNA. Translation: AAF15260.1 .
    AF182066 mRNA. Translation: AAF15261.1 .
    AF182068 , AF182067 Genomic DNA. Translation: AAG09439.1 .
    AF487280 mRNA. Translation: AAM49572.1 .
    AK015462 mRNA. Translation: BAB29857.1 .
    BC144863 mRNA. Translation: AAI44864.1 .
    CCDSi CCDS20388.1. [Q9QXU7-2 ]
    CCDS20389.1. [Q9QXU7-1 ]
    RefSeqi NP_001032628.1. NM_001037539.2. [Q9QXU7-2 ]
    NP_056583.1. NM_015768.2. [Q9QXU7-1 ]
    UniGenei Mm.87365.

    3D structure databases

    ProteinModelPortali Q9QXU7.
    SMRi Q9QXU7. Positions 27-127.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 206046. 1 interaction.
    STRINGi 10090.ENSMUSP00000032152.

    Proteomic databases

    PRIDEi Q9QXU7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000032152 ; ENSMUSP00000032152 ; ENSMUSG00000030069 . [Q9QXU7-1 ]
    ENSMUST00000101120 ; ENSMUSP00000098678 ; ENSMUSG00000030069 . [Q9QXU7-2 ]
    GeneIDi 50501.
    KEGGi mmu:50501.
    UCSCi uc009dbt.1. mouse. [Q9QXU7-1 ]
    uc009dbu.1. mouse. [Q9QXU7-2 ]
    uc009dbv.1. mouse. [Q9QXU7-3 ]

    Organism-specific databases

    CTDi 60675.
    MGIi MGI:1354178. Prok2.

    Phylogenomic databases

    eggNOGi NOG39081.
    GeneTreei ENSGT00390000014799.
    HOGENOMi HOG000004848.
    HOVERGENi HBG031845.
    InParanoidi Q9QXU7.
    OMAi PLTRKNH.
    OrthoDBi EOG7SJD78.
    PhylomeDBi Q9QXU7.
    TreeFami TF332732.

    Enzyme and pathway databases

    Reactomei REACT_207651. G alpha (q) signalling events.

    Miscellaneous databases

    NextBioi 307502.
    PROi Q9QXU7.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9QXU7.
    CleanExi MM_PROK2.
    Genevestigatori Q9QXU7.

    Family and domain databases

    InterProi IPR009523. Prokineticin.
    IPR023569. Prokineticin_domain.
    [Graphical view ]
    PANTHERi PTHR18821. PTHR18821. 1 hit.
    Pfami PF06607. Prokineticin. 1 hit.
    [Graphical view ]
    ProDomi PD059788. Prokineticin. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    ProtoNeti Search...

    Publicationsi

    1. "The mammalian homologues of frog Bv8 are mainly expressed in spermatocytes."
      Wechselberger C., Puglisi R., Lepperdinger G., Boitani C., Kreil G.
      FEBS Lett. 462:177-181(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Strain: 129/Sv.
    2. "Murine Bv8 gene maps near a synteny breakpoint of mouse chromosome 6 and human 3p21."
      Jilek A., Engel E., Beier D., Lepperdinger G.
      Gene 256:189-195(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3).
      Strain: 129/SvJ.
    3. "Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus."
      Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y.
      Nature 417:405-410(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION.
      Strain: C57BL/6.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Testis.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.

    Entry informationi

    Entry nameiPROK2_MOUSE
    AccessioniPrimary (citable) accession number: Q9QXU7
    Secondary accession number(s): B7ZMX7, Q9QXU5, Q9QXU6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 26, 2001
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3