Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QXU7 (PROK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Prokineticin-2

Short name=PK2
Alternative name(s):
Protein Bv8 homolog
Gene names
Name:Prok2
Synonyms:Bv8
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length128 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle By similarity. Ref.3

Subcellular location

Secreted.

Tissue specificity

Expressed in the SCN and among a few other discrete brain areas, including the islands of Calleja, media l preoptic area of the hypothalamus and the shell of the nucleus accumbens. Highly expressed in testis. In the SCN, expression subjected to high amplitude of circadian oscillation.

Developmental stage

Expressed in mid-late pachytene spermatocytes at the stages VII, VIII and IX of the semiferous epithelial cycle.

Induction

Activated by CLOCK and BMAL1 heterodimers and light; inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2).

Sequence similarities

Belongs to the AVIT (prokineticin) family.

Ontologies

Keywords
   Biological processBiological rhythms
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionNeuropeptide
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processangiogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

cell proliferation

Inferred from sequence or structural similarity. Source: UniProtKB

chemotaxis

Inferred from sequence or structural similarity. Source: UniProtKB

circadian rhythm

Inferred from direct assay Ref.3. Source: MGI

coronary vasculature development

Traceable author statement PubMed 20299672. Source: DFLAT

epicardium-derived cardiac endothelial cell differentiation

Traceable author statement PubMed 20299672. Source: DFLAT

epicardium-derived cardiac vascular smooth muscle cell differentiation

Traceable author statement PubMed 20299672. Source: DFLAT

negative regulation of apoptotic process

Inferred from sequence or structural similarity. Source: UniProtKB

neuropeptide signaling pathway

Inferred from electronic annotation. Source: UniProtKB-KW

positive regulation of smooth muscle contraction

Inferred from sequence or structural similarity. Source: UniProtKB

spermatogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

vasculogenesis involved in coronary vascular morphogenesis

Traceable author statement PubMed 20299672. Source: DFLAT

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionG-protein coupled receptor binding

Traceable author statement PubMed 20299672. Source: DFLAT

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9QXU7-1)

Also known as: Bv8-a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9QXU7-2)

Also known as: Bv8-b;

The sequence of this isoform differs from the canonical sequence as follows:
     74-94: Missing.
Isoform 3 (identifier: Q9QXU7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     74-128: SHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK → VSVCTGILGVPSH

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2626 Potential
Chain27 – 128102Prokineticin-2
PRO_0000025810

Amino acid modifications

Disulfide bond33 ↔ 45 By similarity
Disulfide bond39 ↔ 57 By similarity
Disulfide bond44 ↔ 106 By similarity
Disulfide bond67 ↔ 114 By similarity
Disulfide bond108 ↔ 124 By similarity

Natural variations

Alternative sequence74 – 12855SHVAN…CLARK → VSVCTGILGVPSH in isoform 3.
VSP_005221
Alternative sequence74 – 9421Missing in isoform 2.
VSP_005220

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Bv8-a) [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 5F08BA177FDDB58C

FASTA12814,185
        10         20         30         40         50         60 
MGDPRCAPLL LLLLLPLLFT PPAGDAAVIT GACDKDSQCG GGMCCAVSIW VKSIRICTPM 

        70         80         90        100        110        120 
GQVGDSCHPL TRKSHVANGR QERRRAKRRK RKKEVPFWGR RMHHTCPCLP GLACLRTSFN 


RFICLARK 

« Hide

Isoform 2 (Bv8-b) [UniParc].

Checksum: 8FB79BE4D4357C70
Show »

FASTA10711,556
Isoform 3 [UniParc].

Checksum: 28EACBC5E6F7706F
Show »

FASTA868,836

References

« Hide 'large scale' references
[1]"The mammalian homologues of frog Bv8 are mainly expressed in spermatocytes."
Wechselberger C., Puglisi R., Lepperdinger G., Boitani C., Kreil G.
FEBS Lett. 462:177-181(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
Strain: 129/Sv.
[2]"Murine Bv8 gene maps near a synteny breakpoint of mouse chromosome 6 and human 3p21."
Jilek A., Engel E., Beier D., Lepperdinger G.
Gene 256:189-195(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3).
Strain: 129/SvJ.
[3]"Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus."
Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y.
Nature 417:405-410(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION.
Strain: C57BL/6.
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Testis.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF182064 mRNA. Translation: AAF15259.1.
AF182065 mRNA. Translation: AAF15260.1.
AF182066 mRNA. Translation: AAF15261.1.
AF182068, AF182067 Genomic DNA. Translation: AAG09439.1.
AF487280 mRNA. Translation: AAM49572.1.
AK015462 mRNA. Translation: BAB29857.1.
BC144863 mRNA. Translation: AAI44864.1.
RefSeqNP_001032628.1. NM_001037539.2.
NP_056583.1. NM_015768.2.
UniGeneMm.87365.

3D structure databases

ProteinModelPortalQ9QXU7.
SMRQ9QXU7. Positions 27-127.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid206046. 1 interaction.
STRING10090.ENSMUSP00000032152.

Proteomic databases

PRIDEQ9QXU7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000032152; ENSMUSP00000032152; ENSMUSG00000030069. [Q9QXU7-1]
ENSMUST00000101120; ENSMUSP00000098678; ENSMUSG00000030069. [Q9QXU7-2]
GeneID50501.
KEGGmmu:50501.
UCSCuc009dbt.1. mouse. [Q9QXU7-1]
uc009dbu.1. mouse. [Q9QXU7-2]
uc009dbv.1. mouse. [Q9QXU7-3]

Organism-specific databases

CTD60675.
MGIMGI:1354178. Prok2.

Phylogenomic databases

eggNOGNOG39081.
GeneTreeENSGT00390000014799.
HOGENOMHOG000004848.
HOVERGENHBG031845.
InParanoidQ9QXU7.
OMAPLTRKNH.
OrthoDBEOG7SJD78.
PhylomeDBQ9QXU7.
TreeFamTF332732.

Gene expression databases

BgeeQ9QXU7.
CleanExMM_PROK2.
GenevestigatorQ9QXU7.

Family and domain databases

InterProIPR009523. Prokineticin.
IPR023569. Prokineticin_domain.
[Graphical view]
PANTHERPTHR18821. PTHR18821. 1 hit.
PfamPF06607. Prokineticin. 1 hit.
[Graphical view]
ProDomPD059788. Prokineticin. 1 hit.
[Graphical view] [Entries sharing at least one domain]
ProtoNetSearch...

Other

NextBio307502.
PROQ9QXU7.
SOURCESearch...

Entry information

Entry namePROK2_MOUSE
AccessionPrimary (citable) accession number: Q9QXU7
Secondary accession number(s): B7ZMX7, Q9QXU5, Q9QXU6
Entry history
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: May 1, 2000
Last modified: April 16, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot