SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QXU7

- PROK2_MOUSE

UniProt

Q9QXU7 - PROK2_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Prokineticin-2

Gene
Prok2, Bv8
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle By similarity.1 Publication

GO - Molecular functioni

  1. G-protein coupled receptor binding Source: DFLAT

GO - Biological processi

  1. angiogenesis Source: UniProtKB
  2. cell proliferation Source: UniProtKB
  3. chemotaxis Source: UniProtKB
  4. circadian rhythm Source: MGI
  5. coronary vasculature development Source: DFLAT
  6. epicardium-derived cardiac endothelial cell differentiation Source: DFLAT
  7. epicardium-derived cardiac vascular smooth muscle cell differentiation Source: DFLAT
  8. negative regulation of apoptotic process Source: UniProtKB
  9. neuropeptide signaling pathway Source: UniProtKB-KW
  10. positive regulation of smooth muscle contraction Source: UniProtKB
  11. spermatogenesis Source: UniProtKB
  12. vasculogenesis involved in coronary vascular morphogenesis Source: DFLAT
Complete GO annotation...

Keywords - Molecular functioni

Neuropeptide

Keywords - Biological processi

Biological rhythms

Enzyme and pathway databases

ReactomeiREACT_207651. G alpha (q) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Prokineticin-2
Short name:
PK2
Alternative name(s):
Protein Bv8 homolog
Gene namesi
Name:Prok2
Synonyms:Bv8
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 6

Organism-specific databases

MGIiMGI:1354178. Prok2.

Subcellular locationi

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2626 Reviewed predictionAdd
BLAST
Chaini27 – 128102Prokineticin-2PRO_0000025810Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi33 ↔ 45 By similarity
Disulfide bondi39 ↔ 57 By similarity
Disulfide bondi44 ↔ 106 By similarity
Disulfide bondi67 ↔ 114 By similarity
Disulfide bondi108 ↔ 124 By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PRIDEiQ9QXU7.

Expressioni

Tissue specificityi

Expressed in the SCN and among a few other discrete brain areas, including the islands of Calleja, media l preoptic area of the hypothalamus and the shell of the nucleus accumbens. Highly expressed in testis. In the SCN, expression subjected to high amplitude of circadian oscillation.

Developmental stagei

Expressed in mid-late pachytene spermatocytes at the stages VII, VIII and IX of the semiferous epithelial cycle.

Inductioni

Activated by CLOCK and BMAL1 heterodimers and light; inhibited by period genes (PER1, PER2 and PER3) and cryptochrome genes (CRY1 and CRY2).

Gene expression databases

BgeeiQ9QXU7.
CleanExiMM_PROK2.
GenevestigatoriQ9QXU7.

Interactioni

Protein-protein interaction databases

BioGridi206046. 1 interaction.
STRINGi10090.ENSMUSP00000032152.

Structurei

3D structure databases

ProteinModelPortaliQ9QXU7.
SMRiQ9QXU7. Positions 27-127.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG39081.
GeneTreeiENSGT00390000014799.
HOGENOMiHOG000004848.
HOVERGENiHBG031845.
InParanoidiQ9QXU7.
OMAiPLTRKNH.
OrthoDBiEOG7SJD78.
PhylomeDBiQ9QXU7.
TreeFamiTF332732.

Family and domain databases

InterProiIPR009523. Prokineticin.
IPR023569. Prokineticin_domain.
[Graphical view]
PANTHERiPTHR18821. PTHR18821. 1 hit.
PfamiPF06607. Prokineticin. 1 hit.
[Graphical view]
ProDomiPD059788. Prokineticin. 1 hit.
[Graphical view] [Entries sharing at least one domain]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9QXU7-1) [UniParc]FASTAAdd to Basket

Also known as: Bv8-a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGDPRCAPLL LLLLLPLLFT PPAGDAAVIT GACDKDSQCG GGMCCAVSIW    50
VKSIRICTPM GQVGDSCHPL TRKSHVANGR QERRRAKRRK RKKEVPFWGR 100
RMHHTCPCLP GLACLRTSFN RFICLARK 128
Length:128
Mass (Da):14,185
Last modified:May 1, 2000 - v1
Checksum:i5F08BA177FDDB58C
GO
Isoform 2 (identifier: Q9QXU7-2) [UniParc]FASTAAdd to Basket

Also known as: Bv8-b

The sequence of this isoform differs from the canonical sequence as follows:
     74-94: Missing.

Show »
Length:107
Mass (Da):11,556
Checksum:i8FB79BE4D4357C70
GO
Isoform 3 (identifier: Q9QXU7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     74-128: SHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK → VSVCTGILGVPSH

Show »
Length:86
Mass (Da):8,836
Checksum:i28EACBC5E6F7706F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei74 – 12855SHVAN…CLARK → VSVCTGILGVPSH in isoform 3. VSP_005221Add
BLAST
Alternative sequencei74 – 9421Missing in isoform 2. VSP_005220Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF182064 mRNA. Translation: AAF15259.1.
AF182065 mRNA. Translation: AAF15260.1.
AF182066 mRNA. Translation: AAF15261.1.
AF182068, AF182067 Genomic DNA. Translation: AAG09439.1.
AF487280 mRNA. Translation: AAM49572.1.
AK015462 mRNA. Translation: BAB29857.1.
BC144863 mRNA. Translation: AAI44864.1.
CCDSiCCDS20388.1. [Q9QXU7-2]
CCDS20389.1. [Q9QXU7-1]
RefSeqiNP_001032628.1. NM_001037539.2. [Q9QXU7-2]
NP_056583.1. NM_015768.2. [Q9QXU7-1]
UniGeneiMm.87365.

Genome annotation databases

EnsembliENSMUST00000032152; ENSMUSP00000032152; ENSMUSG00000030069. [Q9QXU7-1]
ENSMUST00000101120; ENSMUSP00000098678; ENSMUSG00000030069. [Q9QXU7-2]
GeneIDi50501.
KEGGimmu:50501.
UCSCiuc009dbt.1. mouse. [Q9QXU7-1]
uc009dbu.1. mouse. [Q9QXU7-2]
uc009dbv.1. mouse. [Q9QXU7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF182064 mRNA. Translation: AAF15259.1 .
AF182065 mRNA. Translation: AAF15260.1 .
AF182066 mRNA. Translation: AAF15261.1 .
AF182068 , AF182067 Genomic DNA. Translation: AAG09439.1 .
AF487280 mRNA. Translation: AAM49572.1 .
AK015462 mRNA. Translation: BAB29857.1 .
BC144863 mRNA. Translation: AAI44864.1 .
CCDSi CCDS20388.1. [Q9QXU7-2 ]
CCDS20389.1. [Q9QXU7-1 ]
RefSeqi NP_001032628.1. NM_001037539.2. [Q9QXU7-2 ]
NP_056583.1. NM_015768.2. [Q9QXU7-1 ]
UniGenei Mm.87365.

3D structure databases

ProteinModelPortali Q9QXU7.
SMRi Q9QXU7. Positions 27-127.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 206046. 1 interaction.
STRINGi 10090.ENSMUSP00000032152.

Proteomic databases

PRIDEi Q9QXU7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000032152 ; ENSMUSP00000032152 ; ENSMUSG00000030069 . [Q9QXU7-1 ]
ENSMUST00000101120 ; ENSMUSP00000098678 ; ENSMUSG00000030069 . [Q9QXU7-2 ]
GeneIDi 50501.
KEGGi mmu:50501.
UCSCi uc009dbt.1. mouse. [Q9QXU7-1 ]
uc009dbu.1. mouse. [Q9QXU7-2 ]
uc009dbv.1. mouse. [Q9QXU7-3 ]

Organism-specific databases

CTDi 60675.
MGIi MGI:1354178. Prok2.

Phylogenomic databases

eggNOGi NOG39081.
GeneTreei ENSGT00390000014799.
HOGENOMi HOG000004848.
HOVERGENi HBG031845.
InParanoidi Q9QXU7.
OMAi PLTRKNH.
OrthoDBi EOG7SJD78.
PhylomeDBi Q9QXU7.
TreeFami TF332732.

Enzyme and pathway databases

Reactomei REACT_207651. G alpha (q) signalling events.

Miscellaneous databases

NextBioi 307502.
PROi Q9QXU7.
SOURCEi Search...

Gene expression databases

Bgeei Q9QXU7.
CleanExi MM_PROK2.
Genevestigatori Q9QXU7.

Family and domain databases

InterProi IPR009523. Prokineticin.
IPR023569. Prokineticin_domain.
[Graphical view ]
PANTHERi PTHR18821. PTHR18821. 1 hit.
Pfami PF06607. Prokineticin. 1 hit.
[Graphical view ]
ProDomi PD059788. Prokineticin. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The mammalian homologues of frog Bv8 are mainly expressed in spermatocytes."
    Wechselberger C., Puglisi R., Lepperdinger G., Boitani C., Kreil G.
    FEBS Lett. 462:177-181(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: 129/Sv.
  2. "Murine Bv8 gene maps near a synteny breakpoint of mouse chromosome 6 and human 3p21."
    Jilek A., Engel E., Beier D., Lepperdinger G.
    Gene 256:189-195(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: 129/SvJ.
  3. "Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus."
    Cheng M.Y., Bullock C.M., Li C., Lee A.G., Bermak J.C., Belluzzi J., Weaver D.R., Leslie F.M., Zhou Q.-Y.
    Nature 417:405-410(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION.
    Strain: C57BL/6.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Testis.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiPROK2_MOUSE
AccessioniPrimary (citable) accession number: Q9QXU7
Secondary accession number(s): B7ZMX7, Q9QXU5, Q9QXU6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 26, 2001
Last sequence update: May 1, 2000
Last modified: September 3, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi