Q9QXS1 (PLEC_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Plectin Short name=PCN Short name=PLTN Alternative name(s): Plectin-1 Plectin-6 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 4691 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. May be involved not only in the cross-linking and stabilization of cytoskeletal intermediate filaments network, but also in the regulation of their dynamics. |
| Subunit structure | Homodimer or homotetramer By similarity. Interacts (via actin-binding domain) with SYNE3. Interacts (via CH 1 domain) with VIM (via rod region). Interacts (via N-terminus) with DST isoform 2 (via N-terminus). Interacts with FER. Ref.5 Ref.6 Ref.15 Ref.16 |
| Subcellular location | Cytoplasm › cytoskeleton. Cell junction › hemidesmosome By similarity. |
| Tissue specificity | Expressed at high levels in lung, brain, small intestine, muscle, heart and skin with lower levels found in kidney, liver, uterus, spleen and salivary gland. Ref.2 |
| Domain | The N-terminus interacts with actin, the C-terminus with vimentin, desmin, GFAP, cytokeratins, lamin B; whereas both the N- and the C-terminus can bind integrin beta-4. |
| Post-translational modification | Phosphorylated by CDK1; regulates dissociation from intermediate filaments during mitosis. Isoform PLEC-1A is phosphorylated on Ser-21 By similarity. Isoform PLEC-1A is phosphorylated on Tyr-26. |
| Sequence similarities | Belongs to the plakin or cytolinker family. Contains 1 actin-binding domain. Contains 2 CH (calponin-homology) domains. Contains 33 plectin repeats. Contains 4 spectrin repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell junction Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat |
| Ligand | Actin-binding |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | hemidesmosome assembly Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | contractile fiber Inferred from direct assay PubMed 14627610. Source: MGI cytoskeletonInferred from electronic annotation. Source: UniProtKB-SubCell hemidesmosomeInferred from sequence or structural similarity. Source: UniProtKB sarcolemmaInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 16 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PLEC-1,2A (identifier: Q9QXS1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PLEC-1 (identifier: Q9QXS1-2) The sequence of this isoform differs from the canonical sequence as follows: 202-206: Missing. | ||||||
| Isoform PLEC-1A (identifier: Q9QXS1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLH → MSQHRLRVPEPEGLGSKRTSSEDNLYLAVLRASEGKK 38-180: Missing. 202-206: Missing. | ||||||
| Note: Contains a phosphoserine at position 21 (By similarity). Contains a phosphotyrosine at position 26. | ||||||
| Isoform PLEC-1B,2A (identifier: Q9QXS1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLH → MEPSGSLFPSLVVVGHVVTLAAVWHWRKGHRQAKDEQ 38-180: Missing. | ||||||
| Isoform PLEC-1B (identifier: Q9QXS1-5) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLH → MEPSGSLFPSLVVVGHVVTLAAVWHWRKGHRQAKDEQ 38-180: Missing. 202-206: Missing. | ||||||
| Isoform PLEC-0,1C (identifier: Q9QXS1-6) The sequence of this isoform differs from the canonical sequence as follows: 1-66: MVAGMLMPLD...ARGLVRETFA → MSGEDSEVRP...PAERAVIRIA 67-180: Missing. 202-206: Missing. | ||||||
| Isoform PLEC-0,1C,2A (identifier: Q9QXS1-7) The sequence of this isoform differs from the canonical sequence as follows: 1-66: MVAGMLMPLD...ARGLVRETFA → MSGEDSEVRP...PAERAVIRIA 67-180: Missing. | ||||||
| Isoform PLEC-0,1C,2A,3A (identifier: Q9QXS1-8) The sequence of this isoform differs from the canonical sequence as follows: 1-66: MVAGMLMPLD...ARGLVRETFA → MSGEDSEVRP...PAERAVIRIA 67-180: Missing. 239-239: E → ERDVIRSVRLPRE | ||||||
| Isoform PLEC-1D,2A (identifier: Q9QXS1-9) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MVAGM → MKIVP 6-180: Missing. | ||||||
| Isoform PLEC-1D (identifier: Q9QXS1-10) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MVAGM → MKIVP 6-180: Missing. 202-206: Missing. | ||||||
| Isoform PLEC-1E,2A (identifier: Q9QXS1-11) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MVAGMLMPLDRLRAI → MDPSRAIQHEISSLK 16-180: Missing. | ||||||
| Isoform PLEC-1E (identifier: Q9QXS1-12) The sequence of this isoform differs from the canonical sequence as follows: 1-15: MVAGMLMPLDRLRAI → MDPSRAIQHEISSLK 16-180: Missing. 202-206: Missing. | ||||||
| Isoform PLEC-1F (identifier: Q9QXS1-13) The sequence of this isoform differs from the canonical sequence as follows: 1-28: MVAGMLMPLDRLRAIYEVLFREGVMVAK → MAHLLTSGPPPDEQDFIQAYEEVREKYK 29-180: Missing. 202-206: Missing. | ||||||
| Isoform PLEC-1G (identifier: Q9QXS1-14) The sequence of this isoform differs from the canonical sequence as follows: 1-44: MVAGMLMPLD...SLHPHVPGVT → MAGTWAAKGV...GYLYGQLCCV 45-180: Missing. 202-206: Missing. | ||||||
| Isoform PLEC-1H (identifier: Q9QXS1-15) The sequence of this isoform differs from the canonical sequence as follows: 1-242: Missing. | ||||||
| Isoform PLEC-1I (identifier: Q9QXS1-16) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRP → MNETVCRRKLSPSGSTNTLSRLRGTSVTCTKTS 34-180: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 4691 | 4691 | Plectin | PRO_0000078136 | ||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||
| Domain | 181 – 411 | 231 | Actin-binding | |||||||||||||||||||||||||||||||||||||||
| Domain | 185 – 293 | 109 | CH 1 | |||||||||||||||||||||||||||||||||||||||
| Domain | 306 – 408 | 103 | CH 2 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 653 – 727 | 75 | Spectrin 1 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 748 – 832 | 85 | Spectrin 2 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 845 – 938 | 94 | Spectrin 3 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 1323 – 1423 | 101 | Spectrin 4 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 2795 – 2832 | 38 | Plectin 1 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 2833 – 2870 | 38 | Plectin 2 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 2871 – 2908 | 38 | Plectin 3 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 2909 – 2946 | 38 | Plectin 4 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 2947 – 2984 | 38 | Plectin 5 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 2988 – 3022 | 35 | Plectin 6 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3123 – 3160 | 38 | Plectin 7 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3161 – 3198 | 38 | Plectin 8 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3199 – 3236 | 38 | Plectin 9 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3237 – 3274 | 38 | Plectin 10 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3275 – 3312 | 38 | Plectin 11 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3315 – 3350 | 36 | Plectin 12 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3492 – 3529 | 38 | Plectin 13 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3530 – 3567 | 38 | Plectin 14 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3568 – 3605 | 38 | Plectin 15 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3606 – 3643 | 38 | Plectin 16 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3647 – 3681 | 35 | Plectin 17 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3827 – 3864 | 38 | Plectin 18 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3865 – 3902 | 38 | Plectin 19 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3903 – 3940 | 38 | Plectin 20 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3941 – 3978 | 38 | Plectin 21 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 3982 – 4015 | 34 | Plectin 22 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4070 – 4107 | 38 | Plectin 23 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4108 – 4145 | 38 | Plectin 24 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4146 – 4183 | 38 | Plectin 25 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4184 – 4221 | 38 | Plectin 26 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4225 – 4259 | 35 | Plectin 27 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4272 – 4312 | 41 | Plectin 28 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4415 – 4452 | 38 | Plectin 29 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4453 – 4490 | 38 | Plectin 30 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4491 – 4528 | 38 | Plectin 31 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4529 – 4566 | 38 | Plectin 32 | |||||||||||||||||||||||||||||||||||||||
| Repeat | 4567 – 4604 | 38 | Plectin 33 | |||||||||||||||||||||||||||||||||||||||
| Region | 1 – 1478 | 1478 | Globular 1 By similarity | |||||||||||||||||||||||||||||||||||||||
| Region | 1479 – 2762 | 1284 | Central fibrous rod domain By similarity | |||||||||||||||||||||||||||||||||||||||
| Region | 2763 – 4691 | 1929 | Globular 2 By similarity | |||||||||||||||||||||||||||||||||||||||
| Region | 4257 – 4307 | 51 | Binding to intermediate filaments By similarity | |||||||||||||||||||||||||||||||||||||||
| Region | 4632 – 4647 | 16 | 4 X 4 AA tandem repeats of G-S-R-X | |||||||||||||||||||||||||||||||||||||||
| Coiled coil | 1477 – 1697 | 221 | Potential | |||||||||||||||||||||||||||||||||||||||
| Coiled coil | 1729 – 2764 | 1036 | Potential | |||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 212 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 728 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 823 | 1 | Phosphothreonine Ref.9 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 1443 | 1 | Phosphoserine Ref.8 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 1729 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 2788 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 3040 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 3098 | 1 | N6-acetyllysine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 3369 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 3427 | 1 | N6-acetyllysine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 3797 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4037 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4389 | 1 | Phosphoserine Ref.14 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4391 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4392 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4393 | 1 | Phosphoserine Ref.8 Ref.10 Ref.11 Ref.12 Ref.14 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4396 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4397 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4398 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4399 | 1 | Phosphoserine Ref.13 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4403 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4418 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4546 | 1 | Phosphothreonine; by CDK1 By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4620 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4622 | 1 | Phosphotyrosine Ref.7 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4625 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4629 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4633 | 1 | Phosphoserine Ref.10 Ref.12 | |||||||||||||||||||||||||||||||||||||||
| Modified residue | 4649 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 242 | 242 | Missing in isoform PLEC-1H. | VSP_005040 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 66 | 66 | MVAGM…RETFA → MSGEDSEVRPVAVAEGSSNG SSGSPSPGDTLPWNLGKTQR SRRSGGGSVGNGSVLDPAER AVIRIA in isoform PLEC-0,1C, isoform PLEC-0,1C,2A,3A and isoform PLEC-0,1C,2A. | VSP_005039 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 44 | 44 | MVAGM…VPGVT → MAGTWAAKGVFTSQREVLLE RPCWLDGGCEQVRRGYLYGQ LCCV in isoform PLEC-1G. | VSP_005038 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MVAGM…PRSLH → MSQHRLRVPEPEGLGSKRTS SEDNLYLAVLRASEGKK in isoform PLEC-1A. | VSP_005036 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 37 | 37 | MVAGM…PRSLH → MEPSGSLFPSLVVVGHVVTL AAVWHWRKGHRQAKDEQ in isoform PLEC-1B and isoform PLEC-1B,2A. | VSP_005037 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 33 | 33 | MVAGM…KDRRP → MNETVCRRKLSPSGSTNTLS RLRGTSVTCTKTS in isoform PLEC-1I. | VSP_005035 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 28 | 28 | MVAGM…VMVAK → MAHLLTSGPPPDEQDFIQAY EEVREKYK in isoform PLEC-1F. | VSP_005034 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 15 | 15 | MVAGM…RLRAI → MDPSRAIQHEISSLK in isoform PLEC-1E and isoform PLEC-1E,2A. | VSP_005033 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MVAGM → MKIVP in isoform PLEC-1D and isoform PLEC-1D,2A. | VSP_005032 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 6 – 180 | 175 | Missing in isoform PLEC-1D and isoform PLEC-1D,2A. | VSP_005041 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 16 – 180 | 165 | Missing in isoform PLEC-1E and isoform PLEC-1E,2A. | VSP_005042 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 29 – 180 | 152 | Missing in isoform PLEC-1F. | VSP_005043 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 34 – 180 | 147 | Missing in isoform PLEC-1I. | VSP_005044 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 38 – 180 | 143 | Missing in isoform PLEC-1A, isoform PLEC-1B and isoform PLEC-1B,2A. | VSP_005045 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 45 – 180 | 136 | Missing in isoform PLEC-1G. | VSP_005046 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 67 – 180 | 114 | Missing in isoform PLEC-0,1C, isoform PLEC-0,1C,2A and isoform PLEC-0,1C,2A,3A. | VSP_005047 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 202 – 206 | 5 | Missing in isoform PLEC-1, isoform PLEC-1A, isoform PLEC-1B, isoform PLEC-1D, isoform PLEC-1E, isoform PLEC-1G, isoform PLEC-1F and isoform PLEC-0,1C. | VSP_005048 | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 239 | 1 | E → ERDVIRSVRLPRE in isoform PLEC-0,1C,2A,3A. | VSP_005049 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 199 | 18 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 205 – 207 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 214 – 220 | 7 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 232 | 11 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 244 – 260 | 17 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 270 – 274 | 5 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 278 – 292 | 15 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 293 – 296 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 308 – 319 | 12 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 320 – 322 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 333 – 335 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 339 – 346 | 8 | ||||||||||||||||||||||||||||||||||||||||
| Turn | 350 – 352 | 3 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 355 – 360 | 6 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 378 | 16 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 386 – 389 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Beta strand | 390 – 393 | 4 | ||||||||||||||||||||||||||||||||||||||||
| Helix | 396 – 409 | 14 | ||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Multiple variable first exons: a mechanism for cell- and tissue-specific gene regulation." Zhang T., Haws P., Wu Q. Genome Res. 14:79-89(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING. |
| [2] | "Unusual 5' transcript complexity of plectin isoforms: novel tissue-specific exons modulate actin binding activity." Fuchs P., Zoerer M., Rezniczek G.A., Spazierer D., Oehler S., Castanon M.J., Hauptmann R., Wiche G. Hum. Mol. Genet. 8:2461-2472(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-964, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Brain, Embryo, Heart, Kidney, Skeletal muscle and Testis. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 181-812. Strain: C57BL/6J. Tissue: Embryo. |
| [4] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 629-633, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [5] | "Direct binding of plectin to Fer kinase and negative regulation of its catalytic activity." Lunter P.C., Wiche G. Biochem. Biophys. Res. Commun. 296:904-910(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FER. |
| [6] | "Nesprin-3, a novel outer nuclear membrane protein, associates with the cytoskeletal linker protein plectin." Wilhelmsen K., Litjens S.H.M., Kuikman I., Tshimbalanga N., Janssen H., van den Bout I., Raymond K., Sonnenberg A. J. Cell Biol. 171:799-810(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SYNE3. |
| [7] | "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling." Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y., Kawakami T., Salomon A.R. J. Immunol. 179:5864-5876(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-2788; TYR-3040; TYR-3369; TYR-3797 AND TYR-4622, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-26 (ISOFORM PLEC-1A), MASS SPECTROMETRY. Tissue: Mast cell. |
| [8] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-728; SER-1443 AND SER-4393, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [9] | "Mitochondrial phosphoproteome revealed by an improved IMAC method and MS/MS/MS." Lee J., Xu Y., Chen Y., Sprung R., Kim S.C., Xie S., Zhao Y. Mol. Cell. Proteomics 6:669-676(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-823, MASS SPECTROMETRY. Tissue: Liver. |
| [10] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4393; SER-4397; SER-4629 AND SER-4633, MASS SPECTROMETRY. Tissue: Liver. |
| [11] | "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis." Zhou H., Ye M., Dong J., Han G., Jiang X., Wu R., Zou H. J. Proteome Res. 7:3957-3967(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4391 AND SER-4393, MASS SPECTROMETRY. Tissue: Liver. |
| [12] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-212; SER-1729; SER-4393 AND SER-4633, MASS SPECTROMETRY. Tissue: Melanoma. |
| [13] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4396 AND SER-4399, MASS SPECTROMETRY. Tissue: Macrophage. |
| [14] | "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry." Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J. Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4389 AND SER-4393, MASS SPECTROMETRY. Tissue: Embryonic fibroblast. |
| [15] | "BPAG1 isoform-b: complex distribution pattern in striated and heart muscle and association with plectin and alpha-actinin." Steiner-Champliaud M.F., Schneider Y., Favre B., Paulhe F., Praetzel-Wunder S., Faulkner G., Konieczny P., Raith M., Wiche G., Adebola A., Liem R.K., Langbein L., Sonnenberg A., Fontao L., Borradori L. Exp. Cell Res. 316:297-313(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DST. |
| [16] | "Actin-binding domain of mouse plectin. Crystal structure and binding to vimentin." Sevcik J., Urbanikova L., Kost'an J., Janda L., Wiche G. Eur. J. Biochem. 271:1873-1884(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 181-417, INTERACTION WITH VIM. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY480033 mRNA. Translation: AAR95666.1. AY480038 mRNA. Translation: AAR95671.1. AY480043 mRNA. Translation: AAR95676.1. AF188006 mRNA. Translation: AAF18066.1. AF188007 mRNA. Translation: AAF18067.1. AF188008 mRNA. Translation: AAF18068.1. AF188009 mRNA. Translation: AAF18069.1. AF188010 mRNA. Translation: AAF18070.1. AF188011 mRNA. Translation: AAF18071.1. AF188012 mRNA. Translation: AAF18072.1. AF188013 mRNA. Translation: AAF18073.1. AF188014 mRNA. Translation: AAF18074.1. AF188015 mRNA. Translation: AAF18075.1. AF188016 mRNA. Translation: AAF18076.1. AF188017 mRNA. Translation: AAF18077.1. AF188018 mRNA. Translation: AAF18078.1. AF188019 mRNA. Translation: AAF18079.1. AF188020 mRNA. Translation: AAF18080.1. AF188021 mRNA. Translation: AAF18081.1. AF188022 mRNA. Translation: AAF18082.1. AF188023 mRNA. Translation: AAF18083.1. AK017743 mRNA. No translation available. | ||||||||||||||||||
| IPI | IPI00229509. IPI00400214. IPI00421267. IPI00421268. IPI00421271. IPI00468273. IPI00626385. IPI00944107. IPI01008141. IPI01008579. | ||||||||||||||||||
| PIR | D59404. | ||||||||||||||||||
| RefSeq | NP_001157012.1. NM_001163540.1. NP_001157014.1. NM_001163542.1. NP_001157021.1. NM_001163549.1. NP_001157675.1. NM_001164203.1. NP_035247.2. NM_011117.2. NP_958791.2. NM_201389.2. NP_958796.2. NM_201394.2. | ||||||||||||||||||
| UniGene | Mm.234912. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9QXS1. | ||||||||||||||||||
| SMR | Q9QXS1. Positions 5-101, 181-411, 424-641, 661-1117, 2836-3026, 3118-3358, 3448-3688, 3783-4023, 4028-4267, 4390-4612. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q9QXS1. 3 interactions. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9QXS1. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9QXS1. | ||||||||||||||||||
| PRIDE | Q9QXS1. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSMUST00000165453; ENSMUSP00000127253; ENSMUSG00000022565. ENSMUST00000167754; ENSMUSP00000127867; ENSMUSG00000022565. ENSMUST00000170728; ENSMUSP00000130948; ENSMUSG00000022565. ENSMUST00000170915; ENSMUSP00000131946; ENSMUSG00000022565. ENSMUST00000171634; ENSMUSP00000126936; ENSMUSG00000022565. | ||||||||||||||||||
| GeneID | 18810. | ||||||||||||||||||
| KEGG | mmu:18810. | ||||||||||||||||||
| UCSC | uc007wir.2. mouse. uc007wiw.2. mouse. uc007wjb.2. mouse. uc007wjc.2. mouse. uc007wjd.2. mouse. uc011zuq.1. mouse. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 5339. | ||||||||||||||||||
| MGI | MGI:1277961. Plec. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG5069. | ||||||||||||||||||
| GeneTree | ENSGT00700000104432. | ||||||||||||||||||
| HOVERGEN | HBG053616. | ||||||||||||||||||
| InParanoid | Q9QXS1. | ||||||||||||||||||
| KO | K10388. | ||||||||||||||||||
| OrthoDB | EOG4SN1MR. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9QXS1. | ||||||||||||||||||
| Bgee | Q9QXS1. | ||||||||||||||||||
| CleanEx | MM_PLEC1. | ||||||||||||||||||
| Genevestigator | Q9QXS1. | ||||||||||||||||||
| GermOnline | ENSMUSG00000022565. Mus musculus. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.418.10. 2 hits. | ||||||||||||||||||
| InterPro | IPR001589. Actinin_actin-bd_CS. IPR001715. CH-domain. IPR001101. Plectin_repeat. IPR005326. S10_plectin_N. IPR018159. Spectrin/alpha-actinin. [Graphical view] | ||||||||||||||||||
| Pfam | PF00307. CH. 2 hits. PF00681. Plectin. 18 hits. PF03501. S10_plectin. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00033. CH. 2 hits. SM00250. PLEC. 35 hits. SM00150. SPEC. 6 hits. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF47576. Calponin-homology. 1 hit. | ||||||||||||||||||
| PROSITE | PS00019. ACTININ_1. 1 hit. PS00020. ACTININ_2. 1 hit. PS50021. CH. 2 hits. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q9QXS1. | ||||||||||||||||||
| NextBio | 295126. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PLEC_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QXS1 Secondary accession number(s): Q6S384 Q9QXS3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
