Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Plectin

Gene

Plec

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. May be involved not only in the cross-linking and stabilization of cytoskeletal intermediate filaments network, but also in the regulation of their dynamics.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiR-MMU-2022090. Assembly of collagen fibrils and other multimeric structures.
R-MMU-264870. Caspase-mediated cleavage of cytoskeletal proteins.
R-MMU-446107. Type I hemidesmosome assembly.

Names & Taxonomyi

Protein namesi
Recommended name:
Plectin
Short name:
PCN
Short name:
PLTN
Alternative name(s):
Plectin-1
Plectin-6
Gene namesi
Name:Plec
Synonyms:Plec1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1277961. Plec.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000781361 – 4691PlectinAdd BLAST4691

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei728PhosphoserineCombined sources1
Modified residuei823PhosphothreonineCombined sources1
Modified residuei1055PhosphoserineCombined sources1
Modified residuei1443PhosphoserineBy similarity1
Modified residuei1729PhosphoserineBy similarity1
Modified residuei1733N6-acetyllysineCombined sources1
Modified residuei2639PhosphoserineBy similarity1
Modified residuei2644N6-acetyllysineCombined sources1
Modified residuei2781PhosphoserineBy similarity1
Modified residuei2788PhosphotyrosineCombined sources1
Modified residuei2809PhosphoserineBy similarity1
Modified residuei2893PhosphothreonineBy similarity1
Modified residuei3040PhosphotyrosineCombined sources1
Modified residuei3060N6-acetyllysineCombined sources1
Modified residuei3098N6-acetyllysineBy similarity1
Modified residuei3369PhosphotyrosineCombined sources1
Modified residuei3427N6-acetyllysineBy similarity1
Modified residuei3792PhosphothreonineBy similarity1
Modified residuei3797PhosphotyrosineCombined sources1
Modified residuei4037PhosphothreonineCombined sources1
Modified residuei4061PhosphoserineBy similarity1
Modified residuei4389PhosphoserineCombined sources1
Modified residuei4391PhosphoserineCombined sources1
Modified residuei4392PhosphoserineCombined sources1
Modified residuei4393PhosphoserineCombined sources1
Modified residuei4396PhosphoserineCombined sources1
Modified residuei4397PhosphoserineBy similarity1
Modified residuei4398PhosphoserineBy similarity1
Modified residuei4399PhosphoserineBy similarity1
Modified residuei4400PhosphotyrosineBy similarity1
Modified residuei4403PhosphoserineBy similarity1
Modified residuei4413PhosphoserineBy similarity1
Modified residuei4418PhosphothreonineBy similarity1
Modified residuei4546Phosphothreonine; by CDK1By similarity1
Modified residuei4614PhosphoserineBy similarity1
Modified residuei4620PhosphoserineCombined sources1
Modified residuei4622PhosphotyrosineCombined sources1
Modified residuei4623PhosphoserineBy similarity1
Modified residuei4625PhosphoserineCombined sources1
Modified residuei4629PhosphoserineCombined sources1
Modified residuei4630PhosphothreonineCombined sources1
Modified residuei4633PhosphoserineCombined sources1
Modified residuei4634Omega-N-methylarginineCombined sources1
Modified residuei4647Omega-N-methylarginineCombined sources1
Modified residuei4649PhosphoserineCombined sources1
Modified residuei4682PhosphoserineBy similarity1
Isoform PLEC-1A (identifier: Q9QXS1-3)
Modified residuei21PhosphoserineCombined sources1
Modified residuei26PhosphotyrosineCombined sources1

Post-translational modificationi

Phosphorylated by CDK1; regulates dissociation from intermediate filaments during mitosis. Isoform PLEC-1A is phosphorylated on Ser-21. Isoform PLEC-1A is phosphorylated on Tyr-26.

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ9QXS1.
PeptideAtlasiQ9QXS1.
PRIDEiQ9QXS1.

PTM databases

iPTMnetiQ9QXS1.
PhosphoSitePlusiQ9QXS1.
SwissPalmiQ9QXS1.

Expressioni

Tissue specificityi

Detected in eye lens fiber cells (at protein level) (PubMed:21745462). Expressed at high levels in lung, brain, small intestine, muscle, heart and skin with lower levels found in kidney, liver, uterus, spleen and salivary gland (PubMed:10556294).2 Publications

Gene expression databases

BgeeiENSMUSG00000022565.
CleanExiMM_PLEC1.
ExpressionAtlasiQ9QXS1. baseline and differential.
GenevisibleiQ9QXS1. MM.

Interactioni

Subunit structurei

Homodimer or homotetramer (By similarity). Interacts (via actin-binding domain) with SYNE3 (PubMed:16330710). Interacts (via CH 1 domain) with VIM (via rod region) (PubMed:15128297). Interacts (via N-terminus) with DST isoform 2 (via N-terminus) (PubMed:19932097). Interacts with FER (PubMed:12200133). Interacts with TOR1A (PubMed:18827015). Interacts with ANK3 (By similarity). Identified in complexes that contain VIM, EZR, AHNAK, BFSP1, BFSP2, ANK2, PLEC, PRX and spectrin (PubMed:21745462).By similarity6 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi202243. 11 interactors.
DIPiDIP-32004N.
IntActiQ9QXS1. 7 interactors.
MINTiMINT-1867366.
STRINGi10090.ENSMUSP00000073124.

Structurei

Secondary structure

14691
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi181 – 199Combined sources19
Helixi205 – 207Combined sources3
Turni214 – 220Combined sources7
Helixi222 – 232Combined sources11
Helixi244 – 260Combined sources17
Helixi270 – 274Combined sources5
Helixi278 – 292Combined sources15
Helixi294 – 296Combined sources3
Helixi308 – 319Combined sources12
Turni320 – 322Combined sources3
Helixi333 – 335Combined sources3
Helixi339 – 348Combined sources10
Helixi350 – 352Combined sources3
Helixi355 – 360Combined sources6
Helixi363 – 378Combined sources16
Helixi386 – 389Combined sources4
Beta strandi390 – 393Combined sources4
Helixi396 – 408Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1SH5X-ray2.00A/B181-417[»]
1SH6X-ray2.00A181-417[»]
4Q57X-ray1.80B181-411[»]
ProteinModelPortaliQ9QXS1.
SMRiQ9QXS1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9QXS1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini181 – 411Actin-bindingAdd BLAST231
Domaini185 – 293CH 1PROSITE-ProRule annotationAdd BLAST109
Domaini306 – 408CH 2PROSITE-ProRule annotationAdd BLAST103
Repeati653 – 727Spectrin 1Add BLAST75
Repeati748 – 832Spectrin 2Add BLAST85
Repeati845 – 938Spectrin 3Add BLAST94
Repeati1323 – 1423Spectrin 4Add BLAST101
Repeati2795 – 2832Plectin 1Add BLAST38
Repeati2833 – 2870Plectin 2Add BLAST38
Repeati2871 – 2908Plectin 3Add BLAST38
Repeati2909 – 2946Plectin 4Add BLAST38
Repeati2947 – 2984Plectin 5Add BLAST38
Repeati2988 – 3022Plectin 6Add BLAST35
Repeati3123 – 3160Plectin 7Add BLAST38
Repeati3161 – 3198Plectin 8Add BLAST38
Repeati3199 – 3236Plectin 9Add BLAST38
Repeati3237 – 3274Plectin 10Add BLAST38
Repeati3275 – 3312Plectin 11Add BLAST38
Repeati3315 – 3350Plectin 12Add BLAST36
Repeati3492 – 3529Plectin 13Add BLAST38
Repeati3530 – 3567Plectin 14Add BLAST38
Repeati3568 – 3605Plectin 15Add BLAST38
Repeati3606 – 3643Plectin 16Add BLAST38
Repeati3647 – 3681Plectin 17Add BLAST35
Repeati3827 – 3864Plectin 18Add BLAST38
Repeati3865 – 3902Plectin 19Add BLAST38
Repeati3903 – 3940Plectin 20Add BLAST38
Repeati3941 – 3978Plectin 21Add BLAST38
Repeati3982 – 4015Plectin 22Add BLAST34
Repeati4070 – 4107Plectin 23Add BLAST38
Repeati4108 – 4145Plectin 24Add BLAST38
Repeati4146 – 4183Plectin 25Add BLAST38
Repeati4184 – 4221Plectin 26Add BLAST38
Repeati4225 – 4259Plectin 27Add BLAST35
Repeati4272 – 4312Plectin 28Add BLAST41
Repeati4415 – 4452Plectin 29Add BLAST38
Repeati4453 – 4490Plectin 30Add BLAST38
Repeati4491 – 4528Plectin 31Add BLAST38
Repeati4529 – 4566Plectin 32Add BLAST38
Repeati4567 – 4604Plectin 33Add BLAST38

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 1478Globular 1By similarityAdd BLAST1478
Regioni1479 – 2762Central fibrous rod domainBy similarityAdd BLAST1284
Regioni2763 – 4691Globular 2By similarityAdd BLAST1929
Regioni4257 – 4307Binding to intermediate filamentsBy similarityAdd BLAST51
Regioni4632 – 46474 X 4 AA tandem repeats of G-S-R-XAdd BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1477 – 1697Sequence analysisAdd BLAST221
Coiled coili1729 – 2764Sequence analysisAdd BLAST1036

Domaini

The N-terminus interacts with actin, the C-terminus with vimentin, desmin, GFAP, cytokeratins, lamin B; whereas both the N- and the C-terminus can bind integrin beta-4.

Sequence similaritiesi

Belongs to the plakin or cytolinker family.Curated
Contains 1 actin-binding domain.Curated
Contains 2 CH (calponin-homology) domains.PROSITE-ProRule annotation
Contains 33 plectin repeats.Curated
Contains 4 spectrin repeats.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0516. Eukaryota.
KOG3344. Eukaryota.
COG5045. LUCA.
COG5069. LUCA.
GeneTreeiENSGT00760000119163.
HOVERGENiHBG053616.
InParanoidiQ9QXS1.
KOiK10388.
OMAiYLNKDTH.
OrthoDBiEOG091G0012.

Family and domain databases

CDDicd00014. CH. 2 hits.
Gene3Di1.10.418.10. 2 hits.
3.90.1290.10. 7 hits.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR030269. Plectin.
IPR001101. Plectin_repeat.
IPR005326. S10_plectin_N.
IPR018159. Spectrin/alpha-actinin.
[Graphical view]
PANTHERiPTHR11915:SF247. PTHR11915:SF247. 4 hits.
PfamiPF00307. CH. 2 hits.
PF00681. Plectin. 18 hits.
PF03501. S10_plectin. 1 hit.
[Graphical view]
SMARTiSM00033. CH. 2 hits.
SM00250. PLEC. 35 hits.
SM00150. SPEC. 6 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF75399. SSF75399. 8 hits.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
[Graphical view]

Sequences (16)i

Sequence statusi: Complete.

This entry describes 16 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform PLEC-1,2A (identifier: Q9QXS1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVAGMLMPLD RLRAIYEVLF REGVMVAKKD RRPRSLHPHV PGVTNLQVMR
60 70 80 90 100
AMASLKARGL VRETFAWCHF YWYLTNEGID HLRQYLHLPP EIVPASLQRV
110 120 130 140 150
RRPVAMVIPA RRRSPHVQTM QGPLGCPPKR GPLPAEDPAR EERQVYRRKE
160 170 180 190 200
REEGAPETPV VSATTVGTLA RPGPEPAPAT DERDRVQKKT FTKWVNKHLI
210 220 230 240 250
KHWRAEAQRH ISDLYEDLRD GHNLISLLEV LSGDSLPREK GRMRFHKLQN
260 270 280 290 300
VQIALDYLRH RQVKLVNIRN DDIADGNPKL TLGLIWTIIL HFQISDIQVS
310 320 330 340 350
GQSEDMTAKE KLLLWSQRMV EGYQGLRCDN FTTSWRDGRL FNAIIHRHKP
360 370 380 390 400
MLIDMNKVYR QTNLENLDQA FSVAERDLGV TRLLDPEDVD VPQPDEKSII
410 420 430 440 450
TYVSSLYDAM PRVPGAQDGV RANELQLRWQ EYRELVLLLL QWIRHHTAAF
460 470 480 490 500
EERKFPSSFE EIEILWCQFL KFKETELPAK EADKNRSKVI YQSLEGAVQA
510 520 530 540 550
GQLKIPPGYH PLDVEKEWGK LHVAILEREK QLRSEFERLE CLQRIVSKLQ
560 570 580 590 600
MEAGLCEEQL NQADALLQSD IRLLASGKVA QRAGEVERDL DKADGMIRLL
610 620 630 640 650
FNDVQTLKDG RHPQGEQMYR RVYRLHERLV AIRTEYNLRL KAGVGAPVTQ
660 670 680 690 700
VTLQSTQRRP ELEDSTLRYL QDLLAWVEEN QRRIDSAEWG VDLPSVEAQL
710 720 730 740 750
GSHRGMHQSI EEFRAKIERA RNDESQLSPA TRGAYRDCLG RLDLQYAKLL
760 770 780 790 800
NSSKARLRSL ESLHGFVAAA TKELMWLNEK EEEEVGFDWS DRNTNMAAKK
810 820 830 840 850
ESYSALMREL EMKEKKIKEI QNTGDRLLRE DHPARPTVES FQAALQTQWS
860 870 880 890 900
WMLQLCCCIE AHLKENTAYF QFFSDVREAE EQLQKLQETL RRKYSCDRTI
910 920 930 940 950
TVTRLEDLLQ DAQDEKEQLN EYKGHLSGLA KRAKAIVQLK PRNPAHPVRG
960 970 980 990 1000
HVPLIAVCDY KQVEVTVHKG DQCQLVGPAQ PSHWKVLSGS SSEAAVPSVC
1010 1020 1030 1040 1050
FLVPPPNQEA QEAVARLEAQ HQALVTLWHQ LHVDMKSLLA WQSLSRDIQL
1060 1070 1080 1090 1100
IRSWSLVTFR TLKPEEQRQA LRNLELHYQA FLRDSQDAGG FGPEDRLVAE
1110 1120 1130 1140 1150
REYGSCSRHY QQLLQSLEQG EQEESRCQRC ISELKDIRLQ LEACETRTVH
1160 1170 1180 1190 1200
RLRLPLDKDP ARECAQRIAE QQKAQAEVEG LGKGVARLSA EAEKVLALPE
1210 1220 1230 1240 1250
PSPAAPTLRS ELELTLGKLE QVRSLSAIYL EKLKTISLVI RSTQGAEEVL
1260 1270 1280 1290 1300
KTHEEQLKEA QAVPATLQEL EATKASLKKL RAQAEAQQPV FNTLRDELRG
1310 1320 1330 1340 1350
AQEVGERLQQ RHGERDVEVE RWRERVTQLL ERWQAVLAQT DVRQRELEQL
1360 1370 1380 1390 1400
GRQLRYYRES ADPLSAWLQD AKRRQEQIQA VPIANCQAAR EQLRQEKALL
1410 1420 1430 1440 1450
EEIERHGEKV EECQKFAKQY INAIKDYELQ LITYKAQLEP VASPAKKPKV
1460 1470 1480 1490 1500
QSGSESVIQE YVDLRTRYSE LTTLTSQYIK FISETLRRME EEERLAEQQR
1510 1520 1530 1540 1550
AEERERLAEV EAALEKQRQL AEAHAQAKAQ AELEAQELQR RMQEEVARRE
1560 1570 1580 1590 1600
EAAVDAQQQK RSIQEELQHL RQSSEAEIQA KAQQVEAAER SRMRIEEEIR
1610 1620 1630 1640 1650
VVRLQLETTE RQRGGAEGEL QALRARAEEA EAQKRQAQEE AERLRRQVQD
1660 1670 1680 1690 1700
ESQRKRQAEA ELALRVKAEA EAAREKQRAL QALDELRLQA EEAERRLRQA
1710 1720 1730 1740 1750
EAERARQVQV ALETAQRSAE VELQSKRASF AEKTAQLERT LQEEHVTVAQ
1760 1770 1780 1790 1800
LREEAERRAQ QQAEAERARE EAERELERWQ LKANEALRLR LQAEEVAQQK
1810 1820 1830 1840 1850
SLAQADAEKQ KEEAEREARR RGKAEEQAVR QRELAEQELE KQRQLAEGTA
1860 1870 1880 1890 1900
QQRLAAEQEL IRLRAETEQG EQQRQLLEEE LARLQHEATA ATQKRQELEA
1910 1920 1930 1940 1950
ELAKVRAEME VLLASKARAE EESRSTSEKS KQRLEAEAGR FRELAEEAAR
1960 1970 1980 1990 2000
LRALAEEAKR QRQLAEEDAA RQRAEAERVL TEKLAAISEA TRLKTEAEIA
2010 2020 2030 2040 2050
LKEKEAENER LRRLAEDEAF QRRRLEEQAA LHKADIEERL AQLRKASESE
2060 2070 2080 2090 2100
LERQKGLVED TLRQRRQVEE EIMALKVSFE KAAAGKAELE LELGRIRSNA
2110 2120 2130 2140 2150
EDTMRSKEQA ELEAARQRQL AAEEEQRRRE AEERVQRSLA AEEEAARQRK
2160 2170 2180 2190 2200
VALEEVERLK AKVEEARRLR ERAEQESARQ LQLAQEAAQK RLQAEEKAHA
2210 2220 2230 2240 2250
FVVQQREEEL QQTLQQEQNM LDRLRSEAEA ARRAAEEAEE AREQAEREAA
2260 2270 2280 2290 2300
QSRKQVEEAE RLKQSAEEQA QAQAQAQAAA EKLRKEAEQE AARRAQAEQA
2310 2320 2330 2340 2350
ALKQKQAADA EMEKHKKFAE QTLRQKAQVE QELTTLRLQL EETDHQKSIL
2360 2370 2380 2390 2400
DEELQRLKAE VTEAARQRSQ VEEELFSVRV QMEELGKLKA RIEAENRALI
2410 2420 2430 2440 2450
LRDKDNTQRF LEEEAEKMKQ VAEEAARLSV AAQEAARLRQ LAEEDLAQQR
2460 2470 2480 2490 2500
ALAEKMLKEK MQAVQEATRL KAEAELLQQQ KELAQEQARR LQEDKEQMAQ
2510 2520 2530 2540 2550
QLVEETQGFQ RTLEAERQRQ LEMSAEAERL KLRMAEMSRA QARAEEDAQR
2560 2570 2580 2590 2600
FRKQAEEIGE KLHRTELATQ EKVTLVQTLE IQRQQSDHDA ERLREAIAEL
2610 2620 2630 2640 2650
EREKEKLKQE AKLLQLKSEE MQTVQQEQIL QETQALQKSF LSEKDSLLQR
2660 2670 2680 2690 2700
ERFIEQEKAK LEQLFQDEVA KAKQLREEQQ RQQQQMEQEK QELMASMEEA
2710 2720 2730 2740 2750
RRRQREAEEG VRRKQEELQH LEQQRQQQEK LLAEENQRLR ERLQRLEEEH
2760 2770 2780 2790 2800
RAALAHSEIA TTQAASTKAL PNGRDAPDGP SVEAEPEYTF EGLRQKVPAQ
2810 2820 2830 2840 2850
QLQEAGILSQ EELQRLAQGH TTVAELTQRE DVYRYLKGRS SIAGLLLKPT
2860 2870 2880 2890 2900
NEKLSVYTAL QRQLLSPGTA LILLEAQAAS GFLLDPVRNR RLTVNEAVKE
2910 2920 2930 2940 2950
GVVGPELHHK LLSAERAVTG YKDPYTGEQI SLFQAMKKDL IVRDHGVRLL
2960 2970 2980 2990 3000
EAQIATGGII DPVHSHRVPV DVAYKRGYFD EEMNRILSDP SDDTKGFFDP
3010 3020 3030 3040 3050
NTHENLTYLQ LLERCVEDPE TGLRLLPLTD KAAKGGELVY TDTEARDVFE
3060 3070 3080 3090 3100
KATVSAPFGK FQGRTVTIWE IINSEYFTAE QRRDLLQQFR TGHITVEKII
3110 3120 3130 3140 3150
KIVITVVEEH ERKGQLCFEG LRALVPAAEL LDSGVISHEL YQQLQRGERS
3160 3170 3180 3190 3200
VREVAEADSV RQALRGTNVI AGVWLEEAGQ KLSIYEALKK DLLQPEVAVA
3210 3220 3230 3240 3250
LLEAQAGTGH IIDPATSARL TVDEAVRAGL VGPELHEKLL SAEKAVTGYR
3260 3270 3280 3290 3300
DPYSGQSVSL FQALKKGLIP REQGLRLLDA QLSTGGIVDP SKSHRVPLDV
3310 3320 3330 3340 3350
AYARGYLDKE TNRALTSPRD DARVYHDPST QEPVTYSQLQ QRCRSDQLTG
3360 3370 3380 3390 3400
LSLLPLSEKA VRARQEEVYS ELQARETLEQ AKVEVPVGSF KGRAMTVWEL
3410 3420 3430 3440 3450
ISSEYFTEEQ RQELLRQFRT GKVTVEKVIK IVITIVEEVE TRRQERLSFS
3460 3470 3480 3490 3500
GLRAPVPASE LLDAKILSRA QFDQLKDGKT SVKELSEVGS VRTLLQGSGC
3510 3520 3530 3540 3550
LAGIYLEDSK EKVTIYEAMR RGLLRPSTAT LLLEAQAATG FLVDPVRNQR
3560 3570 3580 3590 3600
LYVHEAVKAG VVGPELHEKL LSAEKAVTGY KDPYSGNTIS LFQAMKKGLV
3610 3620 3630 3640 3650
LRDHAIRLLE AQVATGGIID PVHSHRLPVD VAYQRGYFDE EMNRVLADPS
3660 3670 3680 3690 3700
DDTKGFFDPN THENLTYLQL LERCVEDPET GLRLLPLKGA EKTEVVETTQ
3710 3720 3730 3740 3750
VYTEEETRRA FEETQIDIPG GGSHGGSSMS LWEVMQSNMI PEDQRARLMA
3760 3770 3780 3790 3800
DFQAGRVTKE RMIIIIIEII EKTEIIRQQN LASYDYVRRR LTAEDLYEAR
3810 3820 3830 3840 3850
IISLETYNLF REGTKNLREV LEMESAWRYL YGTGAVAGVY LPGSRQTLTI
3860 3870 3880 3890 3900
YQALKKGLLS AEVARLLLEA QAATGFLLDP VKGERLTVDE AVRKGLVGPE
3910 3920 3930 3940 3950
LHDRLLSAER AVTGYRDPYT EQTISLFQAM KKELIPAEEA LRLLDAQLAT
3960 3970 3980 3990 4000
GGIVDPRLGF HLPLEVAYQR GYLNKDTHDQ LSEPSEVRSY VDPSTDERLS
4010 4020 4030 4040 4050
YTQLLKRCRR DDPSGQMLLL LSDARKLTFR GLRKQITVEE LVRSQVMDEA
4060 4070 4080 4090 4100
TALQLQEGLT SIEEVTKNLQ KFLEGTSCIA GVFVDATKER LSVYQAMKKG
4110 4120 4130 4140 4150
IIRPGTAFEL LEAQAATGYV IDPIKGLKLT VEEAVRMGIV GPEFKDKLLS
4160 4170 4180 4190 4200
AERAVTGYKD PYSGKLISLF QAMKKGLILK DHGIRLLEAQ IATGGIIDPE
4210 4220 4230 4240 4250
ESHRLPVEVA YKRGLFDEEM NEILTDPSDD TKGFFDPNTE ENLTYLQLME
4260 4270 4280 4290 4300
RCITDPQTGL CLLPLKEKKR ERKTSSKSSV RKRRVVIVDP ETGKEMSVYE
4310 4320 4330 4340 4350
AYRKGLIDHQ TYLELSEQEC EWEEITISSS DGVVKSMIID RRSGRQYDID
4360 4370 4380 4390 4400
DAITKNLIDR SALDQYRAGT LSITEFADML SGNAGGFRSR SSSVGSSSSY
4410 4420 4430 4440 4450
PISSAGPRTQ LASWSDPTEE TGPVAGILDT ETLEKVSITE AMHRNLVDNI
4460 4470 4480 4490 4500
TGQRLLEAQA CTGGIIDPST GERFPVTEAV NKGLVDKIMV DRINLAQKAF
4510 4520 4530 4540 4550
CGFEDPRTKT KMSAAQALKK GWLYYEAGQR FLEVQYLTGG LIEPDTPGRV
4560 4570 4580 4590 4600
SLDEALQRGT VDARTAQKLR DVSAYSKYLT CPKTKLKISY KDALDRSMVE
4610 4620 4630 4640 4650
EGTGLRLLEA AAQSSKGYYS PYSVSGSGST AGSRTGSRTG SRAGSRRGSF
4660 4670 4680 4690
DATGSGFSMT FSSSSYSSSG YGRRYASGPS ASLGGPESAV A
Length:4,691
Mass (Da):534,188
Last modified:April 16, 2014 - v3
Checksum:i91A09EC8181137D1
GO
Isoform PLEC-1 (identifier: Q9QXS1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-206: Missing.

Show »
Length:4,686
Mass (Da):533,508
Checksum:i286192092142820A
GO
Isoform PLEC-1A (identifier: Q9QXS1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLH → MSQHRLRVPEPEGLGSKRTSSEDNLYLAVLRASEGKK
     38-180: Missing.
     202-206: Missing.

Show »
Length:4,543
Mass (Da):517,287
Checksum:i0DEF1312838F3117
GO
Isoform PLEC-1B,2A (identifier: Q9QXS1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLH → MEPSGSLFPSLVVVGHVVTLAAVWHWRKGHRQAKDEQ
     38-180: Missing.

Show »
Length:4,548
Mass (Da):517,980
Checksum:i7E79CDB6FA6FA113
GO
Isoform PLEC-1B (identifier: Q9QXS1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLH → MEPSGSLFPSLVVVGHVVTLAAVWHWRKGHRQAKDEQ
     38-180: Missing.
     202-206: Missing.

Show »
Length:4,543
Mass (Da):517,300
Checksum:iC6F750A867F64F15
GO
Isoform PLEC-0,1C (identifier: Q9QXS1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MVAGMLMPLD...ARGLVRETFA → MSGEDSEVRP...PAERAVIRIA
     67-180: Missing.
     202-206: Missing.

Show »
Length:4,572
Mass (Da):519,755
Checksum:i32917732E7F62B40
GO
Isoform PLEC-0,1C,2A (identifier: Q9QXS1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MVAGMLMPLD...ARGLVRETFA → MSGEDSEVRP...PAERAVIRIA
     67-180: Missing.

Show »
Length:4,577
Mass (Da):520,435
Checksum:iB341CDEA4AEBC734
GO
Isoform PLEC-0,1C,2A,3A (identifier: Q9QXS1-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-66: MVAGMLMPLD...ARGLVRETFA → MSGEDSEVRP...PAERAVIRIA
     67-180: Missing.
     239-239: E → ERDVIRSVRLPRE

Show »
Length:4,589
Mass (Da):521,913
Checksum:i16CAABE9A305F7A3
GO
Isoform PLEC-1D,2A (identifier: Q9QXS1-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MVAGM → MKIVP
     6-180: Missing.

Show »
Length:4,516
Mass (Da):514,413
Checksum:i36BEE7A763630B5D
GO
Isoform PLEC-1D (identifier: Q9QXS1-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MVAGM → MKIVP
     6-180: Missing.
     202-206: Missing.

Show »
Length:4,511
Mass (Da):513,733
Checksum:i9A5D1ED70F20893E
GO
Isoform PLEC-1E,2A (identifier: Q9QXS1-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MVAGMLMPLDRLRAI → MDPSRAIQHEISSLK
     16-180: Missing.

Show »
Length:4,526
Mass (Da):515,538
Checksum:i50629AD9DAD55935
GO
Isoform PLEC-1E (identifier: Q9QXS1-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MVAGMLMPLDRLRAI → MDPSRAIQHEISSLK
     16-180: Missing.
     202-206: Missing.

Show »
Length:4,521
Mass (Da):514,858
Checksum:iDC0F769A3EBA7CA3
GO
Isoform PLEC-1F (identifier: Q9QXS1-13) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MVAGMLMPLDRLRAIYEVLFREGVMVAK → MAHLLTSGPPPDEQDFIQAYEEVREKYK
     29-180: Missing.
     202-206: Missing.

Show »
Length:4,534
Mass (Da):516,439
Checksum:i552158F027E35E2F
GO
Isoform PLEC-1G (identifier: Q9QXS1-14) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MVAGMLMPLD...SLHPHVPGVT → MAGTWAAKGV...GYLYGQLCCV
     45-180: Missing.
     202-206: Missing.

Show »
Length:4,550
Mass (Da):518,098
Checksum:iE3F452D98F8841B1
GO
Isoform PLEC-1H (identifier: Q9QXS1-15) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-242: Missing.

Show »
Length:4,449
Mass (Da):506,427
Checksum:iC1A063931DEE299C
GO
Isoform PLEC-1I (identifier: Q9QXS1-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRP → MNETVCRRKLSPSGSTNTLSRLRGTSVTCTKTS
     34-180: Missing.

Show »
Length:4,544
Mass (Da):517,399
Checksum:iCCE0F23C0BA8CD6D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2535A → V in AAR95666 (PubMed:14672974).Curated1
Sequence conflicti2535A → V in AAR95671 (PubMed:14672974).Curated1
Sequence conflicti2535A → V in AAR95676 (PubMed:14672974).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0050401 – 242Missing in isoform PLEC-1H. CuratedAdd BLAST242
Alternative sequenceiVSP_0050391 – 66MVAGM…RETFA → MSGEDSEVRPVAVAEGSSNG SSGSPSPGDTLPWNLGKTQR SRRSGGGSVGNGSVLDPAER AVIRIA in isoform PLEC-0,1C, isoform PLEC-0,1C,2A,3A and isoform PLEC-0,1C,2A. CuratedAdd BLAST66
Alternative sequenceiVSP_0050381 – 44MVAGM…VPGVT → MAGTWAAKGVFTSQREVLLE RPCWLDGGCEQVRRGYLYGQ LCCV in isoform PLEC-1G. CuratedAdd BLAST44
Alternative sequenceiVSP_0050361 – 37MVAGM…PRSLH → MSQHRLRVPEPEGLGSKRTS SEDNLYLAVLRASEGKK in isoform PLEC-1A. CuratedAdd BLAST37
Alternative sequenceiVSP_0050371 – 37MVAGM…PRSLH → MEPSGSLFPSLVVVGHVVTL AAVWHWRKGHRQAKDEQ in isoform PLEC-1B and isoform PLEC-1B,2A. CuratedAdd BLAST37
Alternative sequenceiVSP_0050351 – 33MVAGM…KDRRP → MNETVCRRKLSPSGSTNTLS RLRGTSVTCTKTS in isoform PLEC-1I. CuratedAdd BLAST33
Alternative sequenceiVSP_0050341 – 28MVAGM…VMVAK → MAHLLTSGPPPDEQDFIQAY EEVREKYK in isoform PLEC-1F. CuratedAdd BLAST28
Alternative sequenceiVSP_0050331 – 15MVAGM…RLRAI → MDPSRAIQHEISSLK in isoform PLEC-1E and isoform PLEC-1E,2A. CuratedAdd BLAST15
Alternative sequenceiVSP_0050321 – 5MVAGM → MKIVP in isoform PLEC-1D and isoform PLEC-1D,2A. Curated5
Alternative sequenceiVSP_0050416 – 180Missing in isoform PLEC-1D and isoform PLEC-1D,2A. CuratedAdd BLAST175
Alternative sequenceiVSP_00504216 – 180Missing in isoform PLEC-1E and isoform PLEC-1E,2A. CuratedAdd BLAST165
Alternative sequenceiVSP_00504329 – 180Missing in isoform PLEC-1F. CuratedAdd BLAST152
Alternative sequenceiVSP_00504434 – 180Missing in isoform PLEC-1I. CuratedAdd BLAST147
Alternative sequenceiVSP_00504538 – 180Missing in isoform PLEC-1A, isoform PLEC-1B and isoform PLEC-1B,2A. CuratedAdd BLAST143
Alternative sequenceiVSP_00504645 – 180Missing in isoform PLEC-1G. CuratedAdd BLAST136
Alternative sequenceiVSP_00504767 – 180Missing in isoform PLEC-0,1C, isoform PLEC-0,1C,2A and isoform PLEC-0,1C,2A,3A. CuratedAdd BLAST114
Alternative sequenceiVSP_005048202 – 206Missing in isoform PLEC-1, isoform PLEC-1A, isoform PLEC-1B, isoform PLEC-1D, isoform PLEC-1E, isoform PLEC-1G, isoform PLEC-1F and isoform PLEC-0,1C. Curated5
Alternative sequenceiVSP_005049239E → ERDVIRSVRLPRE in isoform PLEC-0,1C,2A,3A. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY480033 mRNA. Translation: AAR95666.1.
AY480038 mRNA. Translation: AAR95671.1.
AY480043 mRNA. Translation: AAR95676.1.
AC110211 Genomic DNA. No translation available.
AF188006 mRNA. Translation: AAF18066.1.
AF188007 mRNA. Translation: AAF18067.1.
AF188008 mRNA. Translation: AAF18068.1.
AF188009 mRNA. Translation: AAF18069.1.
AF188010 mRNA. Translation: AAF18070.1.
AF188011 mRNA. Translation: AAF18071.1.
AF188012 mRNA. Translation: AAF18072.1.
AF188013 mRNA. Translation: AAF18073.1.
AF188014 mRNA. Translation: AAF18074.1.
AF188015 mRNA. Translation: AAF18075.1.
AF188016 mRNA. Translation: AAF18076.1.
AF188017 mRNA. Translation: AAF18077.1.
AF188018 mRNA. Translation: AAF18078.1.
AF188019 mRNA. Translation: AAF18079.1.
AF188020 mRNA. Translation: AAF18080.1.
AF188021 mRNA. Translation: AAF18081.1.
AF188022 mRNA. Translation: AAF18082.1.
AF188023 mRNA. Translation: AAF18083.1.
AK017743 mRNA. No translation available.
CCDSiCCDS37113.1. [Q9QXS1-13]
CCDS37114.1. [Q9QXS1-2]
CCDS37115.1. [Q9QXS1-14]
CCDS37116.1. [Q9QXS1-3]
CCDS49644.1. [Q9QXS1-5]
CCDS49645.1. [Q9QXS1-4]
CCDS49646.1. [Q9QXS1-10]
CCDS49647.1. [Q9QXS1-1]
CCDS49648.1. [Q9QXS1-12]
CCDS49649.1. [Q9QXS1-8]
PIRiD59404.
RefSeqiNP_001157012.1. NM_001163540.1. [Q9QXS1-1]
NP_001157014.1. NM_001163542.1. [Q9QXS1-8]
NP_001157021.1. NM_001163549.1. [Q9QXS1-4]
NP_001157675.1. NM_001164203.1.
NP_035247.2. NM_011117.2. [Q9QXS1-6]
NP_958791.2. NM_201389.2. [Q9QXS1-2]
NP_958796.2. NM_201394.2. [Q9QXS1-3]
UniGeneiMm.234912.

Genome annotation databases

EnsembliENSMUST00000023226; ENSMUSP00000023226; ENSMUSG00000022565. [Q9QXS1-3]
ENSMUST00000054449; ENSMUSP00000057158; ENSMUSG00000022565. [Q9QXS1-4]
ENSMUST00000071869; ENSMUSP00000071765; ENSMUSG00000022565. [Q9QXS1-12]
ENSMUST00000072692; ENSMUSP00000072478; ENSMUSG00000022565. [Q9QXS1-14]
ENSMUST00000073418; ENSMUSP00000073124; ENSMUSG00000022565. [Q9QXS1-1]
ENSMUST00000074834; ENSMUSP00000074383; ENSMUSG00000022565. [Q9QXS1-13]
ENSMUST00000076442; ENSMUSP00000075772; ENSMUSG00000022565. [Q9QXS1-2]
ENSMUST00000089610; ENSMUSP00000087037; ENSMUSG00000022565. [Q9QXS1-8]
ENSMUST00000169108; ENSMUSP00000126068; ENSMUSG00000022565. [Q9QXS1-10]
ENSMUST00000169714; ENSMUSP00000126526; ENSMUSG00000022565. [Q9QXS1-5]
GeneIDi18810.
KEGGimmu:18810.
UCSCiuc007wir.2. mouse. [Q9QXS1-3]
uc007wis.2. mouse. [Q9QXS1-14]
uc007wit.2. mouse. [Q9QXS1-1]
uc007wiu.2. mouse. [Q9QXS1-5]
uc007wiv.2. mouse. [Q9QXS1-10]
uc007wiw.2. mouse. [Q9QXS1-2]
uc007wiz.2. mouse. [Q9QXS1-12]
uc007wja.2. mouse. [Q9QXS1-13]
uc007wjb.2. mouse. [Q9QXS1-6]
uc007wjd.2. mouse. [Q9QXS1-4]
uc011zuq.1. mouse. [Q9QXS1-8]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY480033 mRNA. Translation: AAR95666.1.
AY480038 mRNA. Translation: AAR95671.1.
AY480043 mRNA. Translation: AAR95676.1.
AC110211 Genomic DNA. No translation available.
AF188006 mRNA. Translation: AAF18066.1.
AF188007 mRNA. Translation: AAF18067.1.
AF188008 mRNA. Translation: AAF18068.1.
AF188009 mRNA. Translation: AAF18069.1.
AF188010 mRNA. Translation: AAF18070.1.
AF188011 mRNA. Translation: AAF18071.1.
AF188012 mRNA. Translation: AAF18072.1.
AF188013 mRNA. Translation: AAF18073.1.
AF188014 mRNA. Translation: AAF18074.1.
AF188015 mRNA. Translation: AAF18075.1.
AF188016 mRNA. Translation: AAF18076.1.
AF188017 mRNA. Translation: AAF18077.1.
AF188018 mRNA. Translation: AAF18078.1.
AF188019 mRNA. Translation: AAF18079.1.
AF188020 mRNA. Translation: AAF18080.1.
AF188021 mRNA. Translation: AAF18081.1.
AF188022 mRNA. Translation: AAF18082.1.
AF188023 mRNA. Translation: AAF18083.1.
AK017743 mRNA. No translation available.
CCDSiCCDS37113.1. [Q9QXS1-13]
CCDS37114.1. [Q9QXS1-2]
CCDS37115.1. [Q9QXS1-14]
CCDS37116.1. [Q9QXS1-3]
CCDS49644.1. [Q9QXS1-5]
CCDS49645.1. [Q9QXS1-4]
CCDS49646.1. [Q9QXS1-10]
CCDS49647.1. [Q9QXS1-1]
CCDS49648.1. [Q9QXS1-12]
CCDS49649.1. [Q9QXS1-8]
PIRiD59404.
RefSeqiNP_001157012.1. NM_001163540.1. [Q9QXS1-1]
NP_001157014.1. NM_001163542.1. [Q9QXS1-8]
NP_001157021.1. NM_001163549.1. [Q9QXS1-4]
NP_001157675.1. NM_001164203.1.
NP_035247.2. NM_011117.2. [Q9QXS1-6]
NP_958791.2. NM_201389.2. [Q9QXS1-2]
NP_958796.2. NM_201394.2. [Q9QXS1-3]
UniGeneiMm.234912.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1SH5X-ray2.00A/B181-417[»]
1SH6X-ray2.00A181-417[»]
4Q57X-ray1.80B181-411[»]
ProteinModelPortaliQ9QXS1.
SMRiQ9QXS1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202243. 11 interactors.
DIPiDIP-32004N.
IntActiQ9QXS1. 7 interactors.
MINTiMINT-1867366.
STRINGi10090.ENSMUSP00000073124.

PTM databases

iPTMnetiQ9QXS1.
PhosphoSitePlusiQ9QXS1.
SwissPalmiQ9QXS1.

Proteomic databases

PaxDbiQ9QXS1.
PeptideAtlasiQ9QXS1.
PRIDEiQ9QXS1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023226; ENSMUSP00000023226; ENSMUSG00000022565. [Q9QXS1-3]
ENSMUST00000054449; ENSMUSP00000057158; ENSMUSG00000022565. [Q9QXS1-4]
ENSMUST00000071869; ENSMUSP00000071765; ENSMUSG00000022565. [Q9QXS1-12]
ENSMUST00000072692; ENSMUSP00000072478; ENSMUSG00000022565. [Q9QXS1-14]
ENSMUST00000073418; ENSMUSP00000073124; ENSMUSG00000022565. [Q9QXS1-1]
ENSMUST00000074834; ENSMUSP00000074383; ENSMUSG00000022565. [Q9QXS1-13]
ENSMUST00000076442; ENSMUSP00000075772; ENSMUSG00000022565. [Q9QXS1-2]
ENSMUST00000089610; ENSMUSP00000087037; ENSMUSG00000022565. [Q9QXS1-8]
ENSMUST00000169108; ENSMUSP00000126068; ENSMUSG00000022565. [Q9QXS1-10]
ENSMUST00000169714; ENSMUSP00000126526; ENSMUSG00000022565. [Q9QXS1-5]
GeneIDi18810.
KEGGimmu:18810.
UCSCiuc007wir.2. mouse. [Q9QXS1-3]
uc007wis.2. mouse. [Q9QXS1-14]
uc007wit.2. mouse. [Q9QXS1-1]
uc007wiu.2. mouse. [Q9QXS1-5]
uc007wiv.2. mouse. [Q9QXS1-10]
uc007wiw.2. mouse. [Q9QXS1-2]
uc007wiz.2. mouse. [Q9QXS1-12]
uc007wja.2. mouse. [Q9QXS1-13]
uc007wjb.2. mouse. [Q9QXS1-6]
uc007wjd.2. mouse. [Q9QXS1-4]
uc011zuq.1. mouse. [Q9QXS1-8]

Organism-specific databases

CTDi5339.
MGIiMGI:1277961. Plec.

Phylogenomic databases

eggNOGiKOG0516. Eukaryota.
KOG3344. Eukaryota.
COG5045. LUCA.
COG5069. LUCA.
GeneTreeiENSGT00760000119163.
HOVERGENiHBG053616.
InParanoidiQ9QXS1.
KOiK10388.
OMAiYLNKDTH.
OrthoDBiEOG091G0012.

Enzyme and pathway databases

ReactomeiR-MMU-2022090. Assembly of collagen fibrils and other multimeric structures.
R-MMU-264870. Caspase-mediated cleavage of cytoskeletal proteins.
R-MMU-446107. Type I hemidesmosome assembly.

Miscellaneous databases

EvolutionaryTraceiQ9QXS1.
PROiQ9QXS1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022565.
CleanExiMM_PLEC1.
ExpressionAtlasiQ9QXS1. baseline and differential.
GenevisibleiQ9QXS1. MM.

Family and domain databases

CDDicd00014. CH. 2 hits.
Gene3Di1.10.418.10. 2 hits.
3.90.1290.10. 7 hits.
InterProiIPR001589. Actinin_actin-bd_CS.
IPR001715. CH-domain.
IPR030269. Plectin.
IPR001101. Plectin_repeat.
IPR005326. S10_plectin_N.
IPR018159. Spectrin/alpha-actinin.
[Graphical view]
PANTHERiPTHR11915:SF247. PTHR11915:SF247. 4 hits.
PfamiPF00307. CH. 2 hits.
PF00681. Plectin. 18 hits.
PF03501. S10_plectin. 1 hit.
[Graphical view]
SMARTiSM00033. CH. 2 hits.
SM00250. PLEC. 35 hits.
SM00150. SPEC. 6 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF75399. SSF75399. 8 hits.
PROSITEiPS00019. ACTININ_1. 1 hit.
PS00020. ACTININ_2. 1 hit.
PS50021. CH. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLEC_MOUSE
AccessioniPrimary (citable) accession number: Q9QXS1
Secondary accession number(s): E9QN87
, Q6S384, Q6S389, Q6S394, Q9CS65, Q9QUT2, Q9QXQ8, Q9QXQ9, Q9QXR0, Q9QXR1, Q9QXR2, Q9QXR3, Q9QXR4, Q9QXR5, Q9QXR6, Q9QXR7, Q9QXR8, Q9QXR9, Q9QXS0, Q9QXS2, Q9QXS3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: April 16, 2014
Last modified: November 30, 2016
This is version 162 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.