SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QXL2

- KI21A_MOUSE

UniProt

Q9QXL2 - KI21A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Kinesin-like protein KIF21A
Gene
Kif21a, Kiaa1708
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi88 – 958ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. microtubule motor activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. microtubule-based movement Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF21A
Gene namesi
Name:Kif21a
Synonyms:Kiaa1708
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 15

Organism-specific databases

MGIiMGI:109188. Kif21a.

Subcellular locationi

Cytoplasmcytoskeleton. Cell projectiondendrite. Cell projectionaxon
Note: In neurons, localized to axons and dendrites.1 Publication

GO - Cellular componenti

  1. axon Source: UniProtKB-SubCell
  2. cytoplasm Source: UniProtKB-KW
  3. dendrite Source: UniProtKB-SubCell
  4. kinesin complex Source: InterPro
  5. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16721672Kinesin-like protein KIF21A
PRO_0000125463Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine By similarity
Modified residuei524 – 5241Phosphoserine By similarity
Modified residuei1241 – 12411Phosphoserine By similarity
Modified residuei1660 – 16601Phosphoserine1 Publication
Modified residuei1662 – 16621Phosphothreonine By similarity
Modified residuei1671 – 16711Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9QXL2.
PaxDbiQ9QXL2.
PRIDEiQ9QXL2.

PTM databases

PhosphoSiteiQ9QXL2.

Expressioni

Tissue specificityi

Widely expressed, with highest expression in brain.1 Publication

Gene expression databases

ArrayExpressiQ9QXL2.
BgeeiQ9QXL2.
CleanExiMM_KIF21A.
GenevestigatoriQ9QXL2.

Interactioni

Protein-protein interaction databases

BioGridi200939. 1 interaction.
IntActiQ9QXL2. 3 interactions.
MINTiMINT-4099770.

Structurei

3D structure databases

ProteinModelPortaliQ9QXL2.
SMRiQ9QXL2. Positions 10-379, 1336-1662.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini9 – 371363Kinesin motor
Add
BLAST
Repeati1343 – 138038WD 1
Add
BLAST
Repeati1383 – 142139WD 2
Add
BLAST
Repeati1447 – 148539WD 3
Add
BLAST
Repeati1488 – 153043WD 4
Add
BLAST
Repeati1539 – 157638WD 5
Add
BLAST
Repeati1580 – 161940WD 6
Add
BLAST
Repeati1622 – 165938WD 7
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili365 – 840476 Reviewed prediction
Add
BLAST
Coiled coili933 – 102189 Reviewed prediction
Add
BLAST
Coiled coili1055 – 108531 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Contains 7 WD repeats.

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00750000117543.
HOGENOMiHOG000280728.
HOVERGENiHBG052247.
InParanoidiQ9QXL2.
KOiK10395.
OrthoDBiEOG708VZ4.
PhylomeDBiQ9QXL2.
TreeFamiTF105224.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF00225. Kinesin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9QXL2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLGAADESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT     50
FDYVFDIDSQ QEQIYTQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT 100
GFDVNIMEEE QGIISRAVRH LFKSIDEKKT SAIKNGLPPP EFKVNAQFLE 150
LYNEEVLDLF DTTRDIDAKN KKSNIRIHED STGGIYTVGV TTRTVNTEPE 200
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQTDAENATD 250
NKLISESSPM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG 300
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP 350
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL 400
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR 450
ARITQLVSEQ ANQVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN 500
ENLRKNLTRA TARSPYFSAS SAFSPTILSS DKETIEIIDL AKKDLEKLKR 550
KEKKKKKRLQ KLEESGREER SVAGKDDNAD TDQEKKEEKG VSEKENNELD 600
VEENQEVSDH EDEEEEEEDE EEEDDIEGEE SSDESDSESD EKANYQADLA 650
NITCEIAIKQ KLIDELENSQ KRLQTLKKQY EEKLMMLQHK IRDTQLERDQ 700
VLQNLGSVES YSEEKAKKVK CEYEKKLHAM NKELQRLQTA QKEHARLLKN 750
QSQYEKQLKK LQQDVMEMKK TKVRLMKQMK EEQEKARLTE SRRNREIAQL 800
KKDQRKRDHQ LRLLEAQKRN QEVVLRRKTE EVTALRRQVR PMSDKVAGKV 850
TRKLSSSESP APDTGSSAAS GEADTSRPGT QQKMRIPVAR VQALPTPTTN 900
GTRKKYQRKG FTGRVFTSKT ARMKWQLLER RVTDIIMQKM TISNMEADMN 950
RLLRQREELT KRREKLSKRR EKIVKESGEG DKSVANIIEE MESLTANIDY 1000
INDSIADCQA NIMQMEEAKE EGETLDVTAV INACTLTEAR YLLDHFLSMG 1050
INKGLQAAQK EAQIKVLEGR LKQTEITSAT QNQLLFHMLK EKAELNPELD 1100
ALLGHALQDL DGAPPENEED SSEEDGPLHS PGSEGSTLSS DLMKLCGEVK 1150
PKNKARRRTT TQMELLYADS SEVASDTSAG DASLSGPLAP VAEGQEIGMN 1200
TETSGTSARD KELLAPSGLP SKIGSISRQS SLSEKKVPEP SPVTRRKAYE 1250
KADKPKAKEH KHSDSGASET SLSPPSSPPS RPRNELNVFN RLTVPQGTPS 1300
VQQDKSDESD SSLSEVHRGI INPFPACKGV RASPLQCVHI AEGHTKAVLC 1350
VDSTDDLLFT GSKDRTCKVW NLVTGQEIMS LGVHPNNVVS VKYCNYTSLV 1400
FTVSTSYIKV WDIRESAKCI RTLTSSGQVT LGEACSASTS RTVAIPSGES 1450
QINQIALNPT GTFLYAASGN AVRMWDLKRF QSTGKLTGHL GPVMCLTVDQ 1500
ISNGQDLIIT GSKDHYIKMF DVTEGALGTV SPTHNFEPPH YDGIEALAIQ 1550
GDNLFSGSRD NGIKKWDLAQ KGLLQQVPNA HKDWVCALGL VPGHPVLLSG 1600
CRGGILKLWN VDTFVPVGEM RGHDSPINAI CVNSTHVFTA ADDRTVRIWK 1650
AHNLQDGQLS DTGDLGEDIA SN 1672
Length:1,672
Mass (Da):186,536
Last modified:July 19, 2004 - v2
Checksum:i1B2480E5129105AB
GO
Isoform 2 (identifier: Q9QXL2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1109-1115: Missing.
     1226-1305: ISRQSSLSEK...QGTPSVQQDK → M

Show »
Length:1,573
Mass (Da):175,588
Checksum:iD64D0EEBF5E9888B
GO
Isoform 3 (identifier: Q9QXL2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1227-1318: Missing.

Show »
Length:1,567
Mass (Da):174,806
Checksum:iC4AC29837E0FC17C
GO
Isoform 4 (identifier: Q9QXL2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q

Show »
Length:1,616
Mass (Da):180,550
Checksum:i430FD674A10FFB34
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei558 – 57013Missing in isoform 2 and isoform 3.
VSP_010873Add
BLAST
Alternative sequencei1109 – 11157Missing in isoform 2.
VSP_010874
Alternative sequencei1226 – 130580ISRQS…VQQDK → M in isoform 2.
VSP_010875Add
BLAST
Alternative sequencei1227 – 131892Missing in isoform 3.
VSP_010876Add
BLAST
Alternative sequencei1262 – 131857HSDSG…SEVHR → Q in isoform 4.
VSP_010877Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1127 – 11271P → A in AAF17083. 1 Publication
Sequence conflicti1311 – 13111S → F1 Publication
Sequence conflicti1321 – 13211I → L1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF202892 mRNA. Translation: AAF17083.1.
BC060698 mRNA. Translation: AAH60698.1.
BC062896 mRNA. Translation: AAH62896.1.
AK129426 mRNA. Translation: BAC98236.1.
AK049303 mRNA. Translation: BAC33669.1.
AK047350 mRNA. Translation: BAC33031.1.
CCDSiCCDS37179.1. [Q9QXL2-2]
CCDS49706.1. [Q9QXL2-3]
CCDS49708.1. [Q9QXL2-1]
RefSeqiNP_001102510.1. NM_001109040.2. [Q9QXL2-1]
NP_001102511.1. NM_001109041.2.
NP_001102512.1. NM_001109042.2. [Q9QXL2-3]
NP_057914.2. NM_016705.4. [Q9QXL2-2]
UniGeneiMm.41379.

Genome annotation databases

EnsembliENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629. [Q9QXL2-1]
ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629. [Q9QXL2-3]
ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629. [Q9QXL2-2]
GeneIDi16564.
KEGGimmu:16564.
UCSCiuc007xhs.2. mouse. [Q9QXL2-1]
uc007xht.2. mouse. [Q9QXL2-2]
uc007xhv.2. mouse. [Q9QXL2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF202892 mRNA. Translation: AAF17083.1 .
BC060698 mRNA. Translation: AAH60698.1 .
BC062896 mRNA. Translation: AAH62896.1 .
AK129426 mRNA. Translation: BAC98236.1 .
AK049303 mRNA. Translation: BAC33669.1 .
AK047350 mRNA. Translation: BAC33031.1 .
CCDSi CCDS37179.1. [Q9QXL2-2 ]
CCDS49706.1. [Q9QXL2-3 ]
CCDS49708.1. [Q9QXL2-1 ]
RefSeqi NP_001102510.1. NM_001109040.2. [Q9QXL2-1 ]
NP_001102511.1. NM_001109041.2.
NP_001102512.1. NM_001109042.2. [Q9QXL2-3 ]
NP_057914.2. NM_016705.4. [Q9QXL2-2 ]
UniGenei Mm.41379.

3D structure databases

ProteinModelPortali Q9QXL2.
SMRi Q9QXL2. Positions 10-379, 1336-1662.
ModBasei Search...

Protein-protein interaction databases

BioGridi 200939. 1 interaction.
IntActi Q9QXL2. 3 interactions.
MINTi MINT-4099770.

PTM databases

PhosphoSitei Q9QXL2.

Proteomic databases

MaxQBi Q9QXL2.
PaxDbi Q9QXL2.
PRIDEi Q9QXL2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000088614 ; ENSMUSP00000085985 ; ENSMUSG00000022629 . [Q9QXL2-1 ]
ENSMUST00000109287 ; ENSMUSP00000104910 ; ENSMUSG00000022629 . [Q9QXL2-3 ]
ENSMUST00000109288 ; ENSMUSP00000104911 ; ENSMUSG00000022629 . [Q9QXL2-2 ]
GeneIDi 16564.
KEGGi mmu:16564.
UCSCi uc007xhs.2. mouse. [Q9QXL2-1 ]
uc007xht.2. mouse. [Q9QXL2-2 ]
uc007xhv.2. mouse. [Q9QXL2-3 ]

Organism-specific databases

CTDi 55605.
MGIi MGI:109188. Kif21a.
Rougei Search...

Phylogenomic databases

eggNOGi COG2319.
GeneTreei ENSGT00750000117543.
HOGENOMi HOG000280728.
HOVERGENi HBG052247.
InParanoidi Q9QXL2.
KOi K10395.
OrthoDBi EOG708VZ4.
PhylomeDBi Q9QXL2.
TreeFami TF105224.

Miscellaneous databases

ChiTaRSi KIF21A. mouse.
NextBioi 290065.
PROi Q9QXL2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9QXL2.
Bgeei Q9QXL2.
CleanExi MM_KIF21A.
Genevestigatori Q9QXL2.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProi IPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
PANTHERi PTHR24115. PTHR24115. 1 hit.
Pfami PF00225. Kinesin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view ]
PRINTSi PR00380. KINESINHEAVY.
SMARTi SM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel dendritic kinesin sorting identified by different process targeting of two related kinesins: KIF21A and KIF21B."
    Marszalek J.R., Weiner J.A., Farlow S.J., Chun J., Goldstein L.S.
    J. Cell Biol. 145:469-479(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-551, NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1129-1672 (ISOFORM 4).
    Strain: C57BL/6J.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 382-1672 (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1660 AND SER-1671, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiKI21A_MOUSE
AccessioniPrimary (citable) accession number: Q9QXL2
Secondary accession number(s): Q6P5H1
, Q6ZPJ8, Q8BWZ9, Q8BXF1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi