Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QXL2

- KI21A_MOUSE

UniProt

Q9QXL2 - KI21A_MOUSE

Protein

Kinesin-like protein KIF21A

Gene

Kif21a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 2 (19 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi88 – 958ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. microtubule motor activity Source: InterPro

    GO - Biological processi

    1. microtubule-based movement Source: InterPro

    Keywords - Molecular functioni

    Motor protein

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kinesin-like protein KIF21A
    Gene namesi
    Name:Kif21a
    Synonyms:Kiaa1708
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 15

    Organism-specific databases

    MGIiMGI:109188. Kif21a.

    Subcellular locationi

    Cytoplasmcytoskeleton 1 Publication. Cell projectiondendrite 1 Publication. Cell projectionaxon 1 Publication
    Note: In neurons, localized to axons and dendrites.

    GO - Cellular componenti

    1. axon Source: UniProtKB-SubCell
    2. cytoplasm Source: UniProtKB-KW
    3. dendrite Source: UniProtKB-SubCell
    4. kinesin complex Source: InterPro
    5. microtubule Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell projection, Cytoplasm, Cytoskeleton, Microtubule

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 16721672Kinesin-like protein KIF21APRO_0000125463Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei524 – 5241PhosphoserineBy similarity
    Modified residuei1241 – 12411PhosphoserineBy similarity
    Modified residuei1660 – 16601Phosphoserine1 Publication
    Modified residuei1662 – 16621PhosphothreonineBy similarity
    Modified residuei1671 – 16711Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9QXL2.
    PaxDbiQ9QXL2.
    PRIDEiQ9QXL2.

    PTM databases

    PhosphoSiteiQ9QXL2.

    Expressioni

    Tissue specificityi

    Widely expressed, with highest expression in brain.1 Publication

    Gene expression databases

    ArrayExpressiQ9QXL2.
    BgeeiQ9QXL2.
    CleanExiMM_KIF21A.
    GenevestigatoriQ9QXL2.

    Interactioni

    Protein-protein interaction databases

    BioGridi200939. 1 interaction.
    IntActiQ9QXL2. 4 interactions.
    MINTiMINT-4099770.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QXL2.
    SMRiQ9QXL2. Positions 10-379, 1336-1662.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini9 – 371363Kinesin motorPROSITE-ProRule annotationAdd
    BLAST
    Repeati1343 – 138038WD 1Add
    BLAST
    Repeati1383 – 142139WD 2Add
    BLAST
    Repeati1447 – 148539WD 3Add
    BLAST
    Repeati1488 – 153043WD 4Add
    BLAST
    Repeati1539 – 157638WD 5Add
    BLAST
    Repeati1580 – 161940WD 6Add
    BLAST
    Repeati1622 – 165938WD 7Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili365 – 840476Sequence AnalysisAdd
    BLAST
    Coiled coili933 – 102189Sequence AnalysisAdd
    BLAST
    Coiled coili1055 – 108531Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation
    Contains 1 kinesin motor domain.PROSITE-ProRule annotation
    Contains 7 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    GeneTreeiENSGT00750000117543.
    HOGENOMiHOG000280728.
    HOVERGENiHBG052247.
    InParanoidiQ9QXL2.
    KOiK10395.
    OrthoDBiEOG708VZ4.
    PhylomeDBiQ9QXL2.
    TreeFamiTF105224.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    3.40.850.10. 1 hit.
    InterProiIPR027640. Kinesin-like_fam.
    IPR019821. Kinesin_motor_CS.
    IPR001752. Kinesin_motor_dom.
    IPR027417. P-loop_NTPase.
    IPR009053. Prefoldin.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PANTHERiPTHR24115. PTHR24115. 1 hit.
    PfamiPF00225. Kinesin. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view]
    PRINTSiPR00380. KINESINHEAVY.
    SMARTiSM00129. KISc. 1 hit.
    SM00320. WD40. 7 hits.
    [Graphical view]
    SUPFAMiSSF46579. SSF46579. 1 hit.
    SSF50978. SSF50978. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
    PS50067. KINESIN_MOTOR_2. 1 hit.
    PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 2 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9QXL2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLGAADESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT     50
    FDYVFDIDSQ QEQIYTQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT 100
    GFDVNIMEEE QGIISRAVRH LFKSIDEKKT SAIKNGLPPP EFKVNAQFLE 150
    LYNEEVLDLF DTTRDIDAKN KKSNIRIHED STGGIYTVGV TTRTVNTEPE 200
    MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQTDAENATD 250
    NKLISESSPM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG 300
    LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP 350
    SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL 400
    MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR 450
    ARITQLVSEQ ANQVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN 500
    ENLRKNLTRA TARSPYFSAS SAFSPTILSS DKETIEIIDL AKKDLEKLKR 550
    KEKKKKKRLQ KLEESGREER SVAGKDDNAD TDQEKKEEKG VSEKENNELD 600
    VEENQEVSDH EDEEEEEEDE EEEDDIEGEE SSDESDSESD EKANYQADLA 650
    NITCEIAIKQ KLIDELENSQ KRLQTLKKQY EEKLMMLQHK IRDTQLERDQ 700
    VLQNLGSVES YSEEKAKKVK CEYEKKLHAM NKELQRLQTA QKEHARLLKN 750
    QSQYEKQLKK LQQDVMEMKK TKVRLMKQMK EEQEKARLTE SRRNREIAQL 800
    KKDQRKRDHQ LRLLEAQKRN QEVVLRRKTE EVTALRRQVR PMSDKVAGKV 850
    TRKLSSSESP APDTGSSAAS GEADTSRPGT QQKMRIPVAR VQALPTPTTN 900
    GTRKKYQRKG FTGRVFTSKT ARMKWQLLER RVTDIIMQKM TISNMEADMN 950
    RLLRQREELT KRREKLSKRR EKIVKESGEG DKSVANIIEE MESLTANIDY 1000
    INDSIADCQA NIMQMEEAKE EGETLDVTAV INACTLTEAR YLLDHFLSMG 1050
    INKGLQAAQK EAQIKVLEGR LKQTEITSAT QNQLLFHMLK EKAELNPELD 1100
    ALLGHALQDL DGAPPENEED SSEEDGPLHS PGSEGSTLSS DLMKLCGEVK 1150
    PKNKARRRTT TQMELLYADS SEVASDTSAG DASLSGPLAP VAEGQEIGMN 1200
    TETSGTSARD KELLAPSGLP SKIGSISRQS SLSEKKVPEP SPVTRRKAYE 1250
    KADKPKAKEH KHSDSGASET SLSPPSSPPS RPRNELNVFN RLTVPQGTPS 1300
    VQQDKSDESD SSLSEVHRGI INPFPACKGV RASPLQCVHI AEGHTKAVLC 1350
    VDSTDDLLFT GSKDRTCKVW NLVTGQEIMS LGVHPNNVVS VKYCNYTSLV 1400
    FTVSTSYIKV WDIRESAKCI RTLTSSGQVT LGEACSASTS RTVAIPSGES 1450
    QINQIALNPT GTFLYAASGN AVRMWDLKRF QSTGKLTGHL GPVMCLTVDQ 1500
    ISNGQDLIIT GSKDHYIKMF DVTEGALGTV SPTHNFEPPH YDGIEALAIQ 1550
    GDNLFSGSRD NGIKKWDLAQ KGLLQQVPNA HKDWVCALGL VPGHPVLLSG 1600
    CRGGILKLWN VDTFVPVGEM RGHDSPINAI CVNSTHVFTA ADDRTVRIWK 1650
    AHNLQDGQLS DTGDLGEDIA SN 1672
    Length:1,672
    Mass (Da):186,536
    Last modified:July 19, 2004 - v2
    Checksum:i1B2480E5129105AB
    GO
    Isoform 2 (identifier: Q9QXL2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         558-570: Missing.
         1109-1115: Missing.
         1226-1305: ISRQSSLSEK...QGTPSVQQDK → M

    Show »
    Length:1,573
    Mass (Da):175,588
    Checksum:iD64D0EEBF5E9888B
    GO
    Isoform 3 (identifier: Q9QXL2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         558-570: Missing.
         1227-1318: Missing.

    Show »
    Length:1,567
    Mass (Da):174,806
    Checksum:iC4AC29837E0FC17C
    GO
    Isoform 4 (identifier: Q9QXL2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q

    Show »
    Length:1,616
    Mass (Da):180,550
    Checksum:i430FD674A10FFB34
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1127 – 11271P → A in AAF17083. (PubMed:10225949)Curated
    Sequence conflicti1311 – 13111S → F(PubMed:10225949)Curated
    Sequence conflicti1321 – 13211I → L(PubMed:10225949)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei558 – 57013Missing in isoform 2 and isoform 3. 2 PublicationsVSP_010873Add
    BLAST
    Alternative sequencei1109 – 11157Missing in isoform 2. 1 PublicationVSP_010874
    Alternative sequencei1226 – 130580ISRQS…VQQDK → M in isoform 2. 1 PublicationVSP_010875Add
    BLAST
    Alternative sequencei1227 – 131892Missing in isoform 3. 1 PublicationVSP_010876Add
    BLAST
    Alternative sequencei1262 – 131857HSDSG…SEVHR → Q in isoform 4. 1 PublicationVSP_010877Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF202892 mRNA. Translation: AAF17083.1.
    BC060698 mRNA. Translation: AAH60698.1.
    BC062896 mRNA. Translation: AAH62896.1.
    AK129426 mRNA. Translation: BAC98236.1.
    AK049303 mRNA. Translation: BAC33669.1.
    AK047350 mRNA. Translation: BAC33031.1.
    CCDSiCCDS37179.1. [Q9QXL2-2]
    CCDS49706.1. [Q9QXL2-3]
    CCDS49708.1. [Q9QXL2-1]
    RefSeqiNP_001102510.1. NM_001109040.2. [Q9QXL2-1]
    NP_001102511.1. NM_001109041.2.
    NP_001102512.1. NM_001109042.2. [Q9QXL2-3]
    NP_057914.2. NM_016705.4. [Q9QXL2-2]
    UniGeneiMm.41379.

    Genome annotation databases

    EnsembliENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629. [Q9QXL2-1]
    ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629. [Q9QXL2-3]
    ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629. [Q9QXL2-2]
    GeneIDi16564.
    KEGGimmu:16564.
    UCSCiuc007xhs.2. mouse. [Q9QXL2-1]
    uc007xht.2. mouse. [Q9QXL2-2]
    uc007xhv.2. mouse. [Q9QXL2-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF202892 mRNA. Translation: AAF17083.1 .
    BC060698 mRNA. Translation: AAH60698.1 .
    BC062896 mRNA. Translation: AAH62896.1 .
    AK129426 mRNA. Translation: BAC98236.1 .
    AK049303 mRNA. Translation: BAC33669.1 .
    AK047350 mRNA. Translation: BAC33031.1 .
    CCDSi CCDS37179.1. [Q9QXL2-2 ]
    CCDS49706.1. [Q9QXL2-3 ]
    CCDS49708.1. [Q9QXL2-1 ]
    RefSeqi NP_001102510.1. NM_001109040.2. [Q9QXL2-1 ]
    NP_001102511.1. NM_001109041.2.
    NP_001102512.1. NM_001109042.2. [Q9QXL2-3 ]
    NP_057914.2. NM_016705.4. [Q9QXL2-2 ]
    UniGenei Mm.41379.

    3D structure databases

    ProteinModelPortali Q9QXL2.
    SMRi Q9QXL2. Positions 10-379, 1336-1662.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 200939. 1 interaction.
    IntActi Q9QXL2. 4 interactions.
    MINTi MINT-4099770.

    PTM databases

    PhosphoSitei Q9QXL2.

    Proteomic databases

    MaxQBi Q9QXL2.
    PaxDbi Q9QXL2.
    PRIDEi Q9QXL2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000088614 ; ENSMUSP00000085985 ; ENSMUSG00000022629 . [Q9QXL2-1 ]
    ENSMUST00000109287 ; ENSMUSP00000104910 ; ENSMUSG00000022629 . [Q9QXL2-3 ]
    ENSMUST00000109288 ; ENSMUSP00000104911 ; ENSMUSG00000022629 . [Q9QXL2-2 ]
    GeneIDi 16564.
    KEGGi mmu:16564.
    UCSCi uc007xhs.2. mouse. [Q9QXL2-1 ]
    uc007xht.2. mouse. [Q9QXL2-2 ]
    uc007xhv.2. mouse. [Q9QXL2-3 ]

    Organism-specific databases

    CTDi 55605.
    MGIi MGI:109188. Kif21a.
    Rougei Search...

    Phylogenomic databases

    eggNOGi COG2319.
    GeneTreei ENSGT00750000117543.
    HOGENOMi HOG000280728.
    HOVERGENi HBG052247.
    InParanoidi Q9QXL2.
    KOi K10395.
    OrthoDBi EOG708VZ4.
    PhylomeDBi Q9QXL2.
    TreeFami TF105224.

    Miscellaneous databases

    ChiTaRSi KIF21A. mouse.
    NextBioi 290065.
    PROi Q9QXL2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9QXL2.
    Bgeei Q9QXL2.
    CleanExi MM_KIF21A.
    Genevestigatori Q9QXL2.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    3.40.850.10. 1 hit.
    InterProi IPR027640. Kinesin-like_fam.
    IPR019821. Kinesin_motor_CS.
    IPR001752. Kinesin_motor_dom.
    IPR027417. P-loop_NTPase.
    IPR009053. Prefoldin.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    PANTHERi PTHR24115. PTHR24115. 1 hit.
    Pfami PF00225. Kinesin. 1 hit.
    PF00400. WD40. 5 hits.
    [Graphical view ]
    PRINTSi PR00380. KINESINHEAVY.
    SMARTi SM00129. KISc. 1 hit.
    SM00320. WD40. 7 hits.
    [Graphical view ]
    SUPFAMi SSF46579. SSF46579. 1 hit.
    SSF50978. SSF50978. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00411. KINESIN_MOTOR_1. 1 hit.
    PS50067. KINESIN_MOTOR_2. 1 hit.
    PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 2 hits.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Novel dendritic kinesin sorting identified by different process targeting of two related kinesins: KIF21A and KIF21B."
      Marszalek J.R., Weiner J.A., Farlow S.J., Chun J., Goldstein L.S.
      J. Cell Biol. 145:469-479(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: C57BL/6.
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-551, NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1129-1672 (ISOFORM 4).
      Strain: C57BL/6J.
    4. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
      DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 382-1672 (ISOFORM 1).
      Tissue: Brain.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1660 AND SER-1671, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.

    Entry informationi

    Entry nameiKI21A_MOUSE
    AccessioniPrimary (citable) accession number: Q9QXL2
    Secondary accession number(s): Q6P5H1
    , Q6ZPJ8, Q8BWZ9, Q8BXF1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: July 19, 2004
    Last modified: October 1, 2014
    This is version 119 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3