Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QXL2 (KI21A_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kinesin-like protein KIF21A
Gene names
Name:Kif21a
Synonyms:Kiaa1708
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1672 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity. Ref.1

Subcellular location

Cytoplasmcytoskeleton. Cell projectiondendrite. Cell projectionaxon. Note: In neurons, localized to axons and dendrites. Ref.1

Tissue specificity

Widely expressed, with highest expression in brain. Ref.1

Sequence similarities

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.

Contains 1 kinesin motor domain.

Contains 7 WD repeats.

Ontologies

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9QXL2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9QXL2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1109-1115: Missing.
     1226-1305: ISRQSSLSEK...QGTPSVQQDK → M
Isoform 3 (identifier: Q9QXL2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1227-1318: Missing.
Isoform 4 (identifier: Q9QXL2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 16721672Kinesin-like protein KIF21A
PRO_0000125463

Regions

Domain9 – 371363Kinesin motor
Repeat1343 – 138038WD 1
Repeat1383 – 142139WD 2
Repeat1447 – 148539WD 3
Repeat1488 – 153043WD 4
Repeat1539 – 157638WD 5
Repeat1580 – 161940WD 6
Repeat1622 – 165938WD 7
Nucleotide binding88 – 958ATP By similarity
Coiled coil365 – 840476 Potential
Coiled coil933 – 102189 Potential
Coiled coil1055 – 108531 Potential

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue5241Phosphoserine By similarity
Modified residue12411Phosphoserine By similarity
Modified residue16601Phosphoserine Ref.5
Modified residue16621Phosphothreonine By similarity
Modified residue16711Phosphoserine Ref.5

Natural variations

Alternative sequence558 – 57013Missing in isoform 2 and isoform 3.
VSP_010873
Alternative sequence1109 – 11157Missing in isoform 2.
VSP_010874
Alternative sequence1226 – 130580ISRQS…VQQDK → M in isoform 2.
VSP_010875
Alternative sequence1227 – 131892Missing in isoform 3.
VSP_010876
Alternative sequence1262 – 131857HSDSG…SEVHR → Q in isoform 4.
VSP_010877

Experimental info

Sequence conflict11271P → A in AAF17083. Ref.1
Sequence conflict13111S → F Ref.1
Sequence conflict13211I → L Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 19, 2004. Version 2.
Checksum: 1B2480E5129105AB

FASTA1,672186,536
        10         20         30         40         50         60 
MLGAADESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT FDYVFDIDSQ 

        70         80         90        100        110        120 
QEQIYTQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT GFDVNIMEEE QGIISRAVRH 

       130        140        150        160        170        180 
LFKSIDEKKT SAIKNGLPPP EFKVNAQFLE LYNEEVLDLF DTTRDIDAKN KKSNIRIHED 

       190        200        210        220        230        240 
STGGIYTVGV TTRTVNTEPE MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC 

       250        260        270        280        290        300 
PQTDAENATD NKLISESSPM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG 

       310        320        330        340        350        360 
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP SDRDFMETLN 

       370        380        390        400        410        420 
TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL MEYKTGKRII DEEGVESIND 

       430        440        450        460        470        480 
MFHENAMLQT ENNNLRVRIK AMQETVDALR ARITQLVSEQ ANQVLARAGE GNEEISNMIH 

       490        500        510        520        530        540 
SYIKEIEDLR AKLLESEAVN ENLRKNLTRA TARSPYFSAS SAFSPTILSS DKETIEIIDL 

       550        560        570        580        590        600 
AKKDLEKLKR KEKKKKKRLQ KLEESGREER SVAGKDDNAD TDQEKKEEKG VSEKENNELD 

       610        620        630        640        650        660 
VEENQEVSDH EDEEEEEEDE EEEDDIEGEE SSDESDSESD EKANYQADLA NITCEIAIKQ 

       670        680        690        700        710        720 
KLIDELENSQ KRLQTLKKQY EEKLMMLQHK IRDTQLERDQ VLQNLGSVES YSEEKAKKVK 

       730        740        750        760        770        780 
CEYEKKLHAM NKELQRLQTA QKEHARLLKN QSQYEKQLKK LQQDVMEMKK TKVRLMKQMK 

       790        800        810        820        830        840 
EEQEKARLTE SRRNREIAQL KKDQRKRDHQ LRLLEAQKRN QEVVLRRKTE EVTALRRQVR 

       850        860        870        880        890        900 
PMSDKVAGKV TRKLSSSESP APDTGSSAAS GEADTSRPGT QQKMRIPVAR VQALPTPTTN 

       910        920        930        940        950        960 
GTRKKYQRKG FTGRVFTSKT ARMKWQLLER RVTDIIMQKM TISNMEADMN RLLRQREELT 

       970        980        990       1000       1010       1020 
KRREKLSKRR EKIVKESGEG DKSVANIIEE MESLTANIDY INDSIADCQA NIMQMEEAKE 

      1030       1040       1050       1060       1070       1080 
EGETLDVTAV INACTLTEAR YLLDHFLSMG INKGLQAAQK EAQIKVLEGR LKQTEITSAT 

      1090       1100       1110       1120       1130       1140 
QNQLLFHMLK EKAELNPELD ALLGHALQDL DGAPPENEED SSEEDGPLHS PGSEGSTLSS 

      1150       1160       1170       1180       1190       1200 
DLMKLCGEVK PKNKARRRTT TQMELLYADS SEVASDTSAG DASLSGPLAP VAEGQEIGMN 

      1210       1220       1230       1240       1250       1260 
TETSGTSARD KELLAPSGLP SKIGSISRQS SLSEKKVPEP SPVTRRKAYE KADKPKAKEH 

      1270       1280       1290       1300       1310       1320 
KHSDSGASET SLSPPSSPPS RPRNELNVFN RLTVPQGTPS VQQDKSDESD SSLSEVHRGI 

      1330       1340       1350       1360       1370       1380 
INPFPACKGV RASPLQCVHI AEGHTKAVLC VDSTDDLLFT GSKDRTCKVW NLVTGQEIMS 

      1390       1400       1410       1420       1430       1440 
LGVHPNNVVS VKYCNYTSLV FTVSTSYIKV WDIRESAKCI RTLTSSGQVT LGEACSASTS 

      1450       1460       1470       1480       1490       1500 
RTVAIPSGES QINQIALNPT GTFLYAASGN AVRMWDLKRF QSTGKLTGHL GPVMCLTVDQ 

      1510       1520       1530       1540       1550       1560 
ISNGQDLIIT GSKDHYIKMF DVTEGALGTV SPTHNFEPPH YDGIEALAIQ GDNLFSGSRD 

      1570       1580       1590       1600       1610       1620 
NGIKKWDLAQ KGLLQQVPNA HKDWVCALGL VPGHPVLLSG CRGGILKLWN VDTFVPVGEM 

      1630       1640       1650       1660       1670 
RGHDSPINAI CVNSTHVFTA ADDRTVRIWK AHNLQDGQLS DTGDLGEDIA SN 

« Hide

Isoform 2 [UniParc].

Checksum: D64D0EEBF5E9888B
Show »

FASTA1,573175,588
Isoform 3 [UniParc].

Checksum: C4AC29837E0FC17C
Show »

FASTA1,567174,806
Isoform 4 [UniParc].

Checksum: 430FD674A10FFB34
Show »

FASTA1,616180,550

References

« Hide 'large scale' references
[1]"Novel dendritic kinesin sorting identified by different process targeting of two related kinesins: KIF21A and KIF21B."
Marszalek J.R., Weiner J.A., Farlow S.J., Chun J., Goldstein L.S.
J. Cell Biol. 145:469-479(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Strain: C57BL/6.
Tissue: Brain.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-551, NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1129-1672 (ISOFORM 4).
Strain: C57BL/6J.
[4]"Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 382-1672 (ISOFORM 1).
Tissue: Brain.
[5]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1660 AND SER-1671, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF202892 mRNA. Translation: AAF17083.1.
BC060698 mRNA. Translation: AAH60698.1.
BC062896 mRNA. Translation: AAH62896.1.
AK129426 mRNA. Translation: BAC98236.1.
AK049303 mRNA. Translation: BAC33669.1.
AK047350 mRNA. Translation: BAC33031.1.
CCDSCCDS37179.1. [Q9QXL2-2]
CCDS49706.1. [Q9QXL2-3]
CCDS49708.1. [Q9QXL2-1]
RefSeqNP_001102510.1. NM_001109040.2. [Q9QXL2-1]
NP_001102511.1. NM_001109041.2.
NP_001102512.1. NM_001109042.2. [Q9QXL2-3]
NP_057914.2. NM_016705.4. [Q9QXL2-2]
UniGeneMm.41379.

3D structure databases

ProteinModelPortalQ9QXL2.
SMRQ9QXL2. Positions 10-379, 1336-1662.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid200939. 1 interaction.
IntActQ9QXL2. 3 interactions.
MINTMINT-4099770.

PTM databases

PhosphoSiteQ9QXL2.

Proteomic databases

MaxQBQ9QXL2.
PaxDbQ9QXL2.
PRIDEQ9QXL2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629. [Q9QXL2-1]
ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629. [Q9QXL2-3]
ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629. [Q9QXL2-2]
GeneID16564.
KEGGmmu:16564.
UCSCuc007xhs.2. mouse. [Q9QXL2-1]
uc007xht.2. mouse. [Q9QXL2-2]
uc007xhv.2. mouse. [Q9QXL2-3]

Organism-specific databases

CTD55605.
MGIMGI:109188. Kif21a.
RougeSearch...

Phylogenomic databases

eggNOGCOG2319.
GeneTreeENSGT00750000117543.
HOGENOMHOG000280728.
HOVERGENHBG052247.
InParanoidQ9QXL2.
KOK10395.
OrthoDBEOG708VZ4.
PhylomeDBQ9QXL2.
TreeFamTF105224.

Gene expression databases

ArrayExpressQ9QXL2.
BgeeQ9QXL2.
CleanExMM_KIF21A.
GenevestigatorQ9QXL2.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERPTHR24115. PTHR24115. 1 hit.
PfamPF00225. Kinesin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSPR00380. KINESINHEAVY.
SMARTSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKIF21A. mouse.
NextBio290065.
PROQ9QXL2.
SOURCESearch...

Entry information

Entry nameKI21A_MOUSE
AccessionPrimary (citable) accession number: Q9QXL2
Secondary accession number(s): Q6P5H1 expand/collapse secondary AC list , Q6ZPJ8, Q8BWZ9, Q8BXF1
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot