Q9QXL2 (KI21A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kinesin-like protein KIF21A | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1672 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity. Ref.1 |
| Subcellular location | Cytoplasm › cytoskeleton. Cell projection › dendrite. Cell projection › axon. Note: In neurons, localized to axons and dendrites. Ref.1 |
| Tissue specificity | Widely expressed, with highest expression in brain. Ref.1 |
| Sequence similarities | Belongs to the kinesin-like protein family. Contains 1 kinesin-motor domain. Contains 7 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell projection Cytoplasm Cytoskeleton Microtubule |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat WD repeat |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Motor protein |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | microtubule-based movement Inferred from electronic annotation. Source: InterPro |
| Cellular_component | axon Inferred from electronic annotation. Source: UniProtKB-SubCell cytoplasmInferred from electronic annotation. Source: UniProtKB-KW dendriteInferred from electronic annotation. Source: UniProtKB-SubCell microtubuleInferred from electronic annotation. Source: UniProtKB-KW microtubule associated complexInferred from electronic annotation. Source: InterPro |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW microtubule motor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9QXL2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9QXL2-2) The sequence of this isoform differs from the canonical sequence as follows: 558-570: Missing. 1109-1115: Missing. 1226-1305: ISRQSSLSEK...QGTPSVQQDK → M | ||||||
| Isoform 3 (identifier: Q9QXL2-3) The sequence of this isoform differs from the canonical sequence as follows: 558-570: Missing. 1227-1318: Missing. | ||||||
| Isoform 4 (identifier: Q9QXL2-4) The sequence of this isoform differs from the canonical sequence as follows: 1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1672 | 1672 | Kinesin-like protein KIF21A | PRO_0000125463 | |||||
Regions | |||||||||
| Domain | 1 – 299 | 299 | Kinesin-motor | ||||||
| Repeat | 1343 – 1380 | 38 | WD 1 | ||||||
| Repeat | 1383 – 1421 | 39 | WD 2 | ||||||
| Repeat | 1447 – 1485 | 39 | WD 3 | ||||||
| Repeat | 1488 – 1530 | 43 | WD 4 | ||||||
| Repeat | 1539 – 1576 | 38 | WD 5 | ||||||
| Repeat | 1580 – 1619 | 40 | WD 6 | ||||||
| Repeat | 1622 – 1659 | 38 | WD 7 | ||||||
| Nucleotide binding | 88 – 95 | 8 | ATP By similarity | ||||||
| Coiled coil | 365 – 840 | 476 | Potential | ||||||
| Coiled coil | 933 – 1021 | 89 | Potential | ||||||
| Coiled coil | 1055 – 1085 | 31 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 80 | 1 | Phosphotyrosine Ref.5 | ||||||
| Modified residue | 87 | 1 | Phosphotyrosine Ref.5 | ||||||
| Modified residue | 524 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1241 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1660 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1662 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 1671 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 558 – 570 | 13 | Missing in isoform 2 and isoform 3. | VSP_010873 | |||||
| Alternative sequence | 1109 – 1115 | 7 | Missing in isoform 2. | VSP_010874 | |||||
| Alternative sequence | 1226 – 1305 | 80 | ISRQS…VQQDK → M in isoform 2. | VSP_010875 | |||||
| Alternative sequence | 1227 – 1318 | 92 | Missing in isoform 3. | VSP_010876 | |||||
| Alternative sequence | 1262 – 1318 | 57 | HSDSG…SEVHR → Q in isoform 4. | VSP_010877 | |||||
Experimental info | |||||||||
| Sequence conflict | 1127 | 1 | P → A in AAF17083. Ref.1 | ||||||
| Sequence conflict | 1311 | 1 | S → F Ref.1 | ||||||
| Sequence conflict | 1321 | 1 | I → L Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Novel dendritic kinesin sorting identified by different process targeting of two related kinesins: KIF21A and KIF21B." Marszalek J.R., Weiner J.A., Farlow S.J., Chun J., Goldstein L.S. J. Cell Biol. 145:469-479(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6. Tissue: Brain. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-551, NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1129-1672 (ISOFORM 4). Strain: C57BL/6J. |
| [4] | "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H. DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 382-1672 (ISOFORM 1). Tissue: Brain. |
| [5] | "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry." Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R. J. Proteome Res. 6:250-262(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-80 AND TYR-87, MASS SPECTROMETRY. Tissue: Liver. |
| [6] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1660 AND SER-1671, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF202892 mRNA. Translation: AAF17083.1. BC060698 mRNA. Translation: AAH60698.1. BC062896 mRNA. Translation: AAH62896.1. AK129426 mRNA. Translation: BAC98236.1. AK049303 mRNA. Translation: BAC33669.1. AK047350 mRNA. Translation: BAC33031.1. |
| IPI | IPI00454081. IPI00454082. IPI00454083. IPI00454084. |
| RefSeq | NP_001102510.1. NM_001109040.1. NP_001102511.1. NM_001109041.1. NP_001102512.1. NM_001109042.1. NP_057914.2. NM_016705.3. |
| UniGene | Mm.41379. |
3D structure databases | |
| ProteinModelPortal | Q9QXL2. |
| SMR | Q9QXL2. Positions 6-402, 1336-1662. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9QXL2. 2 interactions. |
PTM databases | |
| PhosphoSite | Q9QXL2. |
Proteomic databases | |
| PaxDb | Q9QXL2. |
| PRIDE | Q9QXL2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629. ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629. ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629. |
| GeneID | 16564. |
| KEGG | mmu:16564. |
| UCSC | uc007xhs.2. mouse. uc007xht.2. mouse. uc007xhv.2. mouse. |
Organism-specific databases | |
| CTD | 55605. |
| MGI | MGI:109188. Kif21a. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | COG2319. |
| GeneTree | ENSGT00680000099754. |
| HOGENOM | HOG000280728. |
| HOVERGEN | HBG052247. |
| InParanoid | Q9QXL2. |
| KO | K10395. |
| OMA | HKIRDTQ. |
| OrthoDB | EOG479F67. |
Gene expression databases | |
| ArrayExpress | Q9QXL2. |
| Bgee | Q9QXL2. |
| CleanEx | MM_KIF21A. |
| Genevestigator | Q9QXL2. |
| GermOnline | ENSMUSG00000022629. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. 3.40.850.10. 1 hit. |
| InterPro | IPR019821. Kinesin_motor_CS. IPR001752. Kinesin_motor_dom. IPR009053. Prefoldin. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF00225. Kinesin. 1 hit. PF00400. WD40. 5 hits. [Graphical view] |
| PRINTS | PR00380. KINESINHEAVY. |
| SMART | SM00129. KISc. 1 hit. SM00320. WD40. 7 hits. [Graphical view] |
| SUPFAM | SSF46579. Prefoldin. 1 hit. SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00411. KINESIN_MOTOR_DOMAIN1. 1 hit. PS50067. KINESIN_MOTOR_DOMAIN2. 1 hit. PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. 2 hits. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | KIF21A. mouse. |
| NextBio | 290065. |
| SOURCE | Search... |
Entry information
| Entry name | KI21A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QXL2 Secondary accession number(s): Q6P5H1 Q8BXF1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
