Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QXL2

- KI21A_MOUSE

UniProt

Q9QXL2 - KI21A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Kinesin-like protein KIF21A

Gene

Kif21a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Microtubule-binding motor protein probably involved in neuronal axonal transport. In vitro, has a plus-end directed motor activity.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi88 – 958ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATPase activity Source: RefGenome
  2. ATP binding Source: UniProtKB-KW
  3. microtubule motor activity Source: RefGenome

GO - Biological processi

  1. ATP catabolic process Source: GOC
  2. metabolic process Source: GOC
  3. microtubule-based movement Source: RefGenome
Complete GO annotation...

Keywords - Molecular functioni

Motor protein

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-like protein KIF21A
Gene namesi
Name:Kif21a
Synonyms:Kiaa1708
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 15

Organism-specific databases

MGIiMGI:109188. Kif21a.

Subcellular locationi

Cytoplasmcytoskeleton 1 Publication. Cell projectiondendrite 1 Publication. Cell projectionaxon 1 Publication
Note: In neurons, localized to axons and dendrites.

GO - Cellular componenti

  1. cell projection Source: UniProtKB-KW
  2. cytoplasm Source: UniProtKB-KW
  3. kinesin complex Source: RefGenome
  4. microtubule Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16721672Kinesin-like protein KIF21APRO_0000125463Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei524 – 5241PhosphoserineBy similarity
Modified residuei1241 – 12411PhosphoserineBy similarity
Modified residuei1660 – 16601Phosphoserine1 Publication
Modified residuei1662 – 16621PhosphothreonineBy similarity
Modified residuei1671 – 16711Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9QXL2.
PaxDbiQ9QXL2.
PRIDEiQ9QXL2.

PTM databases

PhosphoSiteiQ9QXL2.

Expressioni

Tissue specificityi

Widely expressed, with highest expression in brain.1 Publication

Gene expression databases

BgeeiQ9QXL2.
CleanExiMM_KIF21A.
ExpressionAtlasiQ9QXL2. baseline and differential.
GenevestigatoriQ9QXL2.

Interactioni

Protein-protein interaction databases

BioGridi200939. 1 interaction.
IntActiQ9QXL2. 4 interactions.
MINTiMINT-4099770.

Structurei

3D structure databases

ProteinModelPortaliQ9QXL2.
SMRiQ9QXL2. Positions 7-402, 1336-1662.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini9 – 371363Kinesin motorPROSITE-ProRule annotationAdd
BLAST
Repeati1343 – 138038WD 1Add
BLAST
Repeati1383 – 142139WD 2Add
BLAST
Repeati1447 – 148539WD 3Add
BLAST
Repeati1488 – 153043WD 4Add
BLAST
Repeati1539 – 157638WD 5Add
BLAST
Repeati1580 – 161940WD 6Add
BLAST
Repeati1622 – 165938WD 7Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili365 – 840476Sequence AnalysisAdd
BLAST
Coiled coili933 – 102189Sequence AnalysisAdd
BLAST
Coiled coili1055 – 108531Sequence AnalysisAdd
BLAST

Sequence similaritiesi

Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.PROSITE-ProRule annotation
Contains 1 kinesin motor domain.PROSITE-ProRule annotation
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00770000120453.
HOGENOMiHOG000280728.
HOVERGENiHBG052247.
InParanoidiQ9QXL2.
KOiK10395.
OrthoDBiEOG708VZ4.
PhylomeDBiQ9QXL2.
TreeFamiTF105224.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProiIPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PANTHERiPTHR24115. PTHR24115. 1 hit.
PfamiPF00225. Kinesin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
PRINTSiPR00380. KINESINHEAVY.
SMARTiSM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9QXL2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLGAADESSV RVAVRIRPQL AKEKIEGCHI CTSVTPGEPQ VFLGKDKAFT
60 70 80 90 100
FDYVFDIDSQ QEQIYTQCIE KLIEGCFEGY NATVFAYGQT GAGKTYTMGT
110 120 130 140 150
GFDVNIMEEE QGIISRAVRH LFKSIDEKKT SAIKNGLPPP EFKVNAQFLE
160 170 180 190 200
LYNEEVLDLF DTTRDIDAKN KKSNIRIHED STGGIYTVGV TTRTVNTEPE
210 220 230 240 250
MMQCLKLGAL SRTTASTQMN VQSSRSHAIF TIHVCQTRVC PQTDAENATD
260 270 280 290 300
NKLISESSPM NEFETLTAKF HFVDLAGSER LKRTGATGER AKEGISINCG
310 320 330 340 350
LLALGNVISA LGDKSKRATH VPYRDSKLTR LLQDSLGGNS QTIMIACVSP
360 370 380 390 400
SDRDFMETLN TLKYANRARN IKNKVMVNQD RASQQINALR SEITRLQMEL
410 420 430 440 450
MEYKTGKRII DEEGVESIND MFHENAMLQT ENNNLRVRIK AMQETVDALR
460 470 480 490 500
ARITQLVSEQ ANQVLARAGE GNEEISNMIH SYIKEIEDLR AKLLESEAVN
510 520 530 540 550
ENLRKNLTRA TARSPYFSAS SAFSPTILSS DKETIEIIDL AKKDLEKLKR
560 570 580 590 600
KEKKKKKRLQ KLEESGREER SVAGKDDNAD TDQEKKEEKG VSEKENNELD
610 620 630 640 650
VEENQEVSDH EDEEEEEEDE EEEDDIEGEE SSDESDSESD EKANYQADLA
660 670 680 690 700
NITCEIAIKQ KLIDELENSQ KRLQTLKKQY EEKLMMLQHK IRDTQLERDQ
710 720 730 740 750
VLQNLGSVES YSEEKAKKVK CEYEKKLHAM NKELQRLQTA QKEHARLLKN
760 770 780 790 800
QSQYEKQLKK LQQDVMEMKK TKVRLMKQMK EEQEKARLTE SRRNREIAQL
810 820 830 840 850
KKDQRKRDHQ LRLLEAQKRN QEVVLRRKTE EVTALRRQVR PMSDKVAGKV
860 870 880 890 900
TRKLSSSESP APDTGSSAAS GEADTSRPGT QQKMRIPVAR VQALPTPTTN
910 920 930 940 950
GTRKKYQRKG FTGRVFTSKT ARMKWQLLER RVTDIIMQKM TISNMEADMN
960 970 980 990 1000
RLLRQREELT KRREKLSKRR EKIVKESGEG DKSVANIIEE MESLTANIDY
1010 1020 1030 1040 1050
INDSIADCQA NIMQMEEAKE EGETLDVTAV INACTLTEAR YLLDHFLSMG
1060 1070 1080 1090 1100
INKGLQAAQK EAQIKVLEGR LKQTEITSAT QNQLLFHMLK EKAELNPELD
1110 1120 1130 1140 1150
ALLGHALQDL DGAPPENEED SSEEDGPLHS PGSEGSTLSS DLMKLCGEVK
1160 1170 1180 1190 1200
PKNKARRRTT TQMELLYADS SEVASDTSAG DASLSGPLAP VAEGQEIGMN
1210 1220 1230 1240 1250
TETSGTSARD KELLAPSGLP SKIGSISRQS SLSEKKVPEP SPVTRRKAYE
1260 1270 1280 1290 1300
KADKPKAKEH KHSDSGASET SLSPPSSPPS RPRNELNVFN RLTVPQGTPS
1310 1320 1330 1340 1350
VQQDKSDESD SSLSEVHRGI INPFPACKGV RASPLQCVHI AEGHTKAVLC
1360 1370 1380 1390 1400
VDSTDDLLFT GSKDRTCKVW NLVTGQEIMS LGVHPNNVVS VKYCNYTSLV
1410 1420 1430 1440 1450
FTVSTSYIKV WDIRESAKCI RTLTSSGQVT LGEACSASTS RTVAIPSGES
1460 1470 1480 1490 1500
QINQIALNPT GTFLYAASGN AVRMWDLKRF QSTGKLTGHL GPVMCLTVDQ
1510 1520 1530 1540 1550
ISNGQDLIIT GSKDHYIKMF DVTEGALGTV SPTHNFEPPH YDGIEALAIQ
1560 1570 1580 1590 1600
GDNLFSGSRD NGIKKWDLAQ KGLLQQVPNA HKDWVCALGL VPGHPVLLSG
1610 1620 1630 1640 1650
CRGGILKLWN VDTFVPVGEM RGHDSPINAI CVNSTHVFTA ADDRTVRIWK
1660 1670
AHNLQDGQLS DTGDLGEDIA SN
Length:1,672
Mass (Da):186,536
Last modified:July 19, 2004 - v2
Checksum:i1B2480E5129105AB
GO
Isoform 2 (identifier: Q9QXL2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1109-1115: Missing.
     1226-1305: ISRQSSLSEK...QGTPSVQQDK → M

Show »
Length:1,573
Mass (Da):175,588
Checksum:iD64D0EEBF5E9888B
GO
Isoform 3 (identifier: Q9QXL2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     558-570: Missing.
     1227-1318: Missing.

Show »
Length:1,567
Mass (Da):174,806
Checksum:iC4AC29837E0FC17C
GO
Isoform 4 (identifier: Q9QXL2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1262-1318: HSDSGASETSLSPPSSPPSRPRNELNVFNRLTVPQGTPSVQQDKSDESDSSLSEVHR → Q

Show »
Length:1,616
Mass (Da):180,550
Checksum:i430FD674A10FFB34
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1127 – 11271P → A in AAF17083. (PubMed:10225949)Curated
Sequence conflicti1311 – 13111S → F(PubMed:10225949)Curated
Sequence conflicti1321 – 13211I → L(PubMed:10225949)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei558 – 57013Missing in isoform 2 and isoform 3. 2 PublicationsVSP_010873Add
BLAST
Alternative sequencei1109 – 11157Missing in isoform 2. 1 PublicationVSP_010874
Alternative sequencei1226 – 130580ISRQS…VQQDK → M in isoform 2. 1 PublicationVSP_010875Add
BLAST
Alternative sequencei1227 – 131892Missing in isoform 3. 1 PublicationVSP_010876Add
BLAST
Alternative sequencei1262 – 131857HSDSG…SEVHR → Q in isoform 4. 1 PublicationVSP_010877Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF202892 mRNA. Translation: AAF17083.1.
BC060698 mRNA. Translation: AAH60698.1.
BC062896 mRNA. Translation: AAH62896.1.
AK129426 mRNA. Translation: BAC98236.1.
AK049303 mRNA. Translation: BAC33669.1.
AK047350 mRNA. Translation: BAC33031.1.
CCDSiCCDS37179.1. [Q9QXL2-2]
CCDS49706.1. [Q9QXL2-3]
CCDS49708.1. [Q9QXL2-1]
RefSeqiNP_001102510.1. NM_001109040.2. [Q9QXL2-1]
NP_001102511.1. NM_001109041.2.
NP_001102512.1. NM_001109042.2. [Q9QXL2-3]
NP_057914.2. NM_016705.4. [Q9QXL2-2]
UniGeneiMm.41379.

Genome annotation databases

EnsembliENSMUST00000088614; ENSMUSP00000085985; ENSMUSG00000022629. [Q9QXL2-1]
ENSMUST00000109287; ENSMUSP00000104910; ENSMUSG00000022629. [Q9QXL2-3]
ENSMUST00000109288; ENSMUSP00000104911; ENSMUSG00000022629. [Q9QXL2-2]
GeneIDi16564.
KEGGimmu:16564.
UCSCiuc007xhs.2. mouse. [Q9QXL2-1]
uc007xht.2. mouse. [Q9QXL2-2]
uc007xhv.2. mouse. [Q9QXL2-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF202892 mRNA. Translation: AAF17083.1 .
BC060698 mRNA. Translation: AAH60698.1 .
BC062896 mRNA. Translation: AAH62896.1 .
AK129426 mRNA. Translation: BAC98236.1 .
AK049303 mRNA. Translation: BAC33669.1 .
AK047350 mRNA. Translation: BAC33031.1 .
CCDSi CCDS37179.1. [Q9QXL2-2 ]
CCDS49706.1. [Q9QXL2-3 ]
CCDS49708.1. [Q9QXL2-1 ]
RefSeqi NP_001102510.1. NM_001109040.2. [Q9QXL2-1 ]
NP_001102511.1. NM_001109041.2.
NP_001102512.1. NM_001109042.2. [Q9QXL2-3 ]
NP_057914.2. NM_016705.4. [Q9QXL2-2 ]
UniGenei Mm.41379.

3D structure databases

ProteinModelPortali Q9QXL2.
SMRi Q9QXL2. Positions 7-402, 1336-1662.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 200939. 1 interaction.
IntActi Q9QXL2. 4 interactions.
MINTi MINT-4099770.

PTM databases

PhosphoSitei Q9QXL2.

Proteomic databases

MaxQBi Q9QXL2.
PaxDbi Q9QXL2.
PRIDEi Q9QXL2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000088614 ; ENSMUSP00000085985 ; ENSMUSG00000022629 . [Q9QXL2-1 ]
ENSMUST00000109287 ; ENSMUSP00000104910 ; ENSMUSG00000022629 . [Q9QXL2-3 ]
ENSMUST00000109288 ; ENSMUSP00000104911 ; ENSMUSG00000022629 . [Q9QXL2-2 ]
GeneIDi 16564.
KEGGi mmu:16564.
UCSCi uc007xhs.2. mouse. [Q9QXL2-1 ]
uc007xht.2. mouse. [Q9QXL2-2 ]
uc007xhv.2. mouse. [Q9QXL2-3 ]

Organism-specific databases

CTDi 55605.
MGIi MGI:109188. Kif21a.
Rougei Search...

Phylogenomic databases

eggNOGi COG2319.
GeneTreei ENSGT00770000120453.
HOGENOMi HOG000280728.
HOVERGENi HBG052247.
InParanoidi Q9QXL2.
KOi K10395.
OrthoDBi EOG708VZ4.
PhylomeDBi Q9QXL2.
TreeFami TF105224.

Miscellaneous databases

NextBioi 290065.
PROi Q9QXL2.
SOURCEi Search...

Gene expression databases

Bgeei Q9QXL2.
CleanExi MM_KIF21A.
ExpressionAtlasi Q9QXL2. baseline and differential.
Genevestigatori Q9QXL2.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
3.40.850.10. 1 hit.
InterProi IPR027640. Kinesin-like_fam.
IPR019821. Kinesin_motor_CS.
IPR001752. Kinesin_motor_dom.
IPR027417. P-loop_NTPase.
IPR009053. Prefoldin.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
PANTHERi PTHR24115. PTHR24115. 1 hit.
Pfami PF00225. Kinesin. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view ]
PRINTSi PR00380. KINESINHEAVY.
SMARTi SM00129. KISc. 1 hit.
SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF46579. SSF46579. 1 hit.
SSF50978. SSF50978. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00411. KINESIN_MOTOR_1. 1 hit.
PS50067. KINESIN_MOTOR_2. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel dendritic kinesin sorting identified by different process targeting of two related kinesins: KIF21A and KIF21B."
    Marszalek J.R., Weiner J.A., Farlow S.J., Chun J., Goldstein L.S.
    J. Cell Biol. 145:469-479(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-551, NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1129-1672 (ISOFORM 4).
    Strain: C57BL/6J.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 382-1672 (ISOFORM 1).
    Tissue: Brain.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1660 AND SER-1671, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiKI21A_MOUSE
AccessioniPrimary (citable) accession number: Q9QXL2
Secondary accession number(s): Q6P5H1
, Q6ZPJ8, Q8BWZ9, Q8BXF1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: July 19, 2004
Last modified: November 26, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3