Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cysteine and histidine-rich protein 1

Gene

Cyhr1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri17 – 63RING-type; degenerateAdd BLAST47
Zinc fingeri59 – 132TRAF-typePROSITE-ProRule annotationAdd BLAST74

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine and histidine-rich protein 1
Gene namesi
Name:Cyhr1
Synonyms:Chrp, Kiaa0496
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1859320. Cyhr1.

Subcellular locationi

  • Cytoplasm 1 Publication
  • Cytoplasmperinuclear region 1 Publication

  • Note: Shows a prominent perinuclear and cytoplasmic localization.

GO - Cellular componenti

  • cytoplasm Source: MGI
  • nuclear envelope Source: MGI
  • nucleoplasm Source: MGI
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003288531 – 311Cysteine and histidine-rich protein 1Add BLAST311

Proteomic databases

EPDiQ9QXA1.
PaxDbiQ9QXA1.
PeptideAtlasiQ9QXA1.
PRIDEiQ9QXA1.

PTM databases

PhosphoSitePlusiQ9QXA1.

Expressioni

Tissue specificityi

Expressed in heart, brain, liver, testis and kidney.1 Publication

Gene expression databases

BgeeiENSMUSG00000053929.
ExpressionAtlasiQ9QXA1. baseline and differential.
GenevisibleiQ9QXA1. MM.

Interactioni

Subunit structurei

Interacts with LGALS3.2 Publications

Protein-protein interaction databases

BioGridi207579. 1 interactor.
STRINGi10090.ENSMUSP00000080043.

Structurei

3D structure databases

ProteinModelPortaliQ9QXA1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CYHR1 family.Curated
Contains 1 RING-type zinc finger.Curated
Contains 1 TRAF-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri17 – 63RING-type; degenerateAdd BLAST47
Zinc fingeri59 – 132TRAF-typePROSITE-ProRule annotationAdd BLAST74

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3002. Eukaryota.
ENOG410XVP0. LUCA.
GeneTreeiENSGT00390000018258.
HOGENOMiHOG000006931.
HOVERGENiHBG071683.
InParanoidiQ9QXA1.
OMAiLPSECQF.
PhylomeDBiQ9QXA1.
TreeFamiTF324281.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.90.890.10. 1 hit.
InterProiIPR013323. SIAH-type.
IPR008974. TRAF-like.
IPR013083. Znf_RING/FYVE/PHD.
IPR001293. Znf_TRAF.
[Graphical view]
SUPFAMiSSF49599. SSF49599. 1 hit.
PROSITEiPS50145. ZF_TRAF. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QXA1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSKPRTEWS TVLSHLVLAG VSLHAAVSSV QCTNGHLMCA GCFIHLLADA
60 70 80 90 100
RLKEEQATCP NCRCEISKSL CCRNLAVEKA VSELPSECGF CLRQFPRSLL
110 120 130 140 150
ERHQKEECQD RVTQCKYKRI GCPWHGPFHE LTVHEAACAH PTKTGNELME
160 170 180 190 200
ILDEMDQSHR KEMQLYNSIF SLLSFEKIGY TEVQFRPYRT DDFITRLYYE
210 220 230 240 250
TPRFTVLNQT WVLKARVNDS ERNPNLSCKR TLSFQLLLKS KVTAPLECSF
260 270 280 290 300
LLLKGPYDDV RISPVIYHFV FTNESNETDY VPLPIIDSVE CNKLLAAKNI
310
NLRLFLFQIQ K
Length:311
Mass (Da):35,757
Last modified:May 1, 2000 - v1
Checksum:iC9DBBAEE3939E6DF
GO
Isoform 2 (identifier: Q9QXA1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MVSKPRTEWSTVLSHLVLAGVSLHAAVSSV → MSGAEEAGGG...CLDLPKASVY
     182-311: EVQFRPYRTD...LRLFLFQIQK → VWVFGPYLWS...TLGQRTRSTC

Show »
Length:375
Mass (Da):39,690
Checksum:i1E249922E1689857
GO
Isoform 3 (identifier: Q9QXA1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: Missing.
     182-311: EVQFRPYRTD...LRLFLFQIQK → VWVFGPYLWS...TLGQRTRSTC

Note: No experimental confirmation available.
Show »
Length:250
Mass (Da):28,110
Checksum:i25EBA2DE83E9EA87
GO
Isoform 4 (identifier: Q9QXA1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-311: CTNGHLMCAG...LRLFLFQIQK → SSRGAAAGFL...ALHTQRLQWE

Show »
Length:192
Mass (Da):20,156
Checksum:i6741B678DAAE7ABE
GO

Sequence cautioni

The sequence BAC97966 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0328211 – 37Missing in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0328221 – 30MVSKP…AVSSV → MSGAEEAGGGGPAAGPAGAV PAGVGVGAGPGAAAGPAAAA LGEAAGPGIPDEAALAGARQ LQEAAGDPDAPPKKRLRAAE AAEAAAAAVAAGSGKLEERL YSVLCCTVCLDLPKASVY in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03282332 – 311CTNGH…FQIQK → SSRGAAAGFLLQTFAAIIML APGPSTHEDCLAGAWVATVI GLPLLAFDFHWVNGDRSSAN LLLGGGMVLAVAGDHLGPEG CSVAGQAVLLVVAVTILIVA VFTANTYGMWGGTLLGVAGL LSRLEEDRLLLLPKEDVCRW ALAAGSWAYCRALHTQRLQW E in isoform 4. 2 PublicationsAdd BLAST280
Alternative sequenceiVSP_032824182 – 311EVQFR…FQIQK → VWVFGPYLWSTEQEEHSIKS DPVYRCSLKATEPPEAGKKL FGDRVPEQAEGLSSNCRTGN GCPQMSKLDQARPTGSHGSR ASVTSSEHVGEQEPGHTLGQ RTRSTC in isoform 2 and isoform 3. 2 PublicationsAdd BLAST130

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251516 mRNA. Translation: CAB62575.1.
AK129156 mRNA. Translation: BAC97966.1. Different initiation.
AK004009 mRNA. Translation: BAB23122.1.
BC016196 mRNA. Translation: AAH16196.1.
BC025112 mRNA. Translation: AAH25112.1.
BC062184 mRNA. Translation: AAH62184.1.
BC082772 mRNA. Translation: AAH82772.1.
CCDSiCCDS27581.1. [Q9QXA1-1]
CCDS27582.1. [Q9QXA1-4]
RefSeqiNP_001263251.1. NM_001276322.1. [Q9QXA1-4]
NP_001263262.1. NM_001276333.1. [Q9QXA1-4]
NP_001263263.1. NM_001276334.1. [Q9QXA1-4]
NP_001263264.1. NM_001276335.1. [Q9QXA1-4]
NP_062269.1. NM_019396.3. [Q9QXA1-1]
NP_851293.1. NM_180962.2. [Q9QXA1-4]
XP_006521232.1. XM_006521169.3. [Q9QXA1-1]
UniGeneiMm.247752.
Mm.392807.
Mm.491122.

Genome annotation databases

EnsembliENSMUST00000066677; ENSMUSP00000063317; ENSMUSG00000053929. [Q9QXA1-4]
ENSMUST00000081291; ENSMUSP00000080043; ENSMUSG00000053929. [Q9QXA1-1]
ENSMUST00000177359; ENSMUSP00000135505; ENSMUSG00000053929. [Q9QXA1-4]
GeneIDi54151.
KEGGimmu:54151.
UCSCiuc007wlf.2. mouse. [Q9QXA1-1]
uc007wli.2. mouse. [Q9QXA1-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251516 mRNA. Translation: CAB62575.1.
AK129156 mRNA. Translation: BAC97966.1. Different initiation.
AK004009 mRNA. Translation: BAB23122.1.
BC016196 mRNA. Translation: AAH16196.1.
BC025112 mRNA. Translation: AAH25112.1.
BC062184 mRNA. Translation: AAH62184.1.
BC082772 mRNA. Translation: AAH82772.1.
CCDSiCCDS27581.1. [Q9QXA1-1]
CCDS27582.1. [Q9QXA1-4]
RefSeqiNP_001263251.1. NM_001276322.1. [Q9QXA1-4]
NP_001263262.1. NM_001276333.1. [Q9QXA1-4]
NP_001263263.1. NM_001276334.1. [Q9QXA1-4]
NP_001263264.1. NM_001276335.1. [Q9QXA1-4]
NP_062269.1. NM_019396.3. [Q9QXA1-1]
NP_851293.1. NM_180962.2. [Q9QXA1-4]
XP_006521232.1. XM_006521169.3. [Q9QXA1-1]
UniGeneiMm.247752.
Mm.392807.
Mm.491122.

3D structure databases

ProteinModelPortaliQ9QXA1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207579. 1 interactor.
STRINGi10090.ENSMUSP00000080043.

PTM databases

PhosphoSitePlusiQ9QXA1.

Proteomic databases

EPDiQ9QXA1.
PaxDbiQ9QXA1.
PeptideAtlasiQ9QXA1.
PRIDEiQ9QXA1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000066677; ENSMUSP00000063317; ENSMUSG00000053929. [Q9QXA1-4]
ENSMUST00000081291; ENSMUSP00000080043; ENSMUSG00000053929. [Q9QXA1-1]
ENSMUST00000177359; ENSMUSP00000135505; ENSMUSG00000053929. [Q9QXA1-4]
GeneIDi54151.
KEGGimmu:54151.
UCSCiuc007wlf.2. mouse. [Q9QXA1-1]
uc007wli.2. mouse. [Q9QXA1-4]

Organism-specific databases

CTDi50626.
MGIiMGI:1859320. Cyhr1.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3002. Eukaryota.
ENOG410XVP0. LUCA.
GeneTreeiENSGT00390000018258.
HOGENOMiHOG000006931.
HOVERGENiHBG071683.
InParanoidiQ9QXA1.
OMAiLPSECQF.
PhylomeDBiQ9QXA1.
TreeFamiTF324281.

Miscellaneous databases

ChiTaRSiCyhr1. mouse.
PROiQ9QXA1.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000053929.
ExpressionAtlasiQ9QXA1. baseline and differential.
GenevisibleiQ9QXA1. MM.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
3.90.890.10. 1 hit.
InterProiIPR013323. SIAH-type.
IPR008974. TRAF-like.
IPR013083. Znf_RING/FYVE/PHD.
IPR001293. Znf_TRAF.
[Graphical view]
SUPFAMiSSF49599. SSF49599. 1 hit.
PROSITEiPS50145. ZF_TRAF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCYHR1_MOUSE
AccessioniPrimary (citable) accession number: Q9QXA1
Secondary accession number(s): Q6P6J7, Q6ZQA2, Q9D134
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 1, 2000
Last modified: November 30, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.