Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cysteine and histidine-rich protein 1

Gene

Cyhr1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri17 – 63RING-type; degenerateAdd BLAST47
Zinc fingeri59 – 132TRAF-typePROSITE-ProRule annotationAdd BLAST74

GO - Molecular functioni

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Cysteine and histidine-rich protein 1
Gene namesi
Name:Cyhr1
Synonyms:Chrp, Kiaa0496
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1859320 Cyhr1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003288531 – 311Cysteine and histidine-rich protein 1Add BLAST311

Proteomic databases

EPDiQ9QXA1
PaxDbiQ9QXA1
PeptideAtlasiQ9QXA1
PRIDEiQ9QXA1

PTM databases

PhosphoSitePlusiQ9QXA1

Expressioni

Tissue specificityi

Expressed in heart, brain, liver, testis and kidney.1 Publication

Gene expression databases

BgeeiENSMUSG00000053929
ExpressionAtlasiQ9QXA1 baseline and differential
GenevisibleiQ9QXA1 MM

Interactioni

Subunit structurei

Interacts with LGALS3.2 Publications

Protein-protein interaction databases

BioGridi207579, 1 interactor
STRINGi10090.ENSMUSP00000080043

Structurei

3D structure databases

ProteinModelPortaliQ9QXA1
SMRiQ9QXA1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CYHR1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri17 – 63RING-type; degenerateAdd BLAST47
Zinc fingeri59 – 132TRAF-typePROSITE-ProRule annotationAdd BLAST74

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3002 Eukaryota
ENOG410XVP0 LUCA
GeneTreeiENSGT00390000018258
HOGENOMiHOG000006931
HOVERGENiHBG071683
InParanoidiQ9QXA1
OMAiSQRDPHQ
PhylomeDBiQ9QXA1
TreeFamiTF324281

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR008974 TRAF-like
IPR013083 Znf_RING/FYVE/PHD
IPR001293 Znf_TRAF
SUPFAMiSSF49599 SSF49599, 1 hit
PROSITEiView protein in PROSITE
PS50145 ZF_TRAF, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9QXA1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSKPRTEWS TVLSHLVLAG VSLHAAVSSV QCTNGHLMCA GCFIHLLADA
60 70 80 90 100
RLKEEQATCP NCRCEISKSL CCRNLAVEKA VSELPSECGF CLRQFPRSLL
110 120 130 140 150
ERHQKEECQD RVTQCKYKRI GCPWHGPFHE LTVHEAACAH PTKTGNELME
160 170 180 190 200
ILDEMDQSHR KEMQLYNSIF SLLSFEKIGY TEVQFRPYRT DDFITRLYYE
210 220 230 240 250
TPRFTVLNQT WVLKARVNDS ERNPNLSCKR TLSFQLLLKS KVTAPLECSF
260 270 280 290 300
LLLKGPYDDV RISPVIYHFV FTNESNETDY VPLPIIDSVE CNKLLAAKNI
310
NLRLFLFQIQ K
Length:311
Mass (Da):35,757
Last modified:May 1, 2000 - v1
Checksum:iC9DBBAEE3939E6DF
GO
Isoform 2 (identifier: Q9QXA1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MVSKPRTEWSTVLSHLVLAGVSLHAAVSSV → MSGAEEAGGG...CLDLPKASVY
     182-311: EVQFRPYRTD...LRLFLFQIQK → VWVFGPYLWS...TLGQRTRSTC

Show »
Length:375
Mass (Da):39,690
Checksum:i1E249922E1689857
GO
Isoform 3 (identifier: Q9QXA1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: Missing.
     182-311: EVQFRPYRTD...LRLFLFQIQK → VWVFGPYLWS...TLGQRTRSTC

Note: No experimental confirmation available.
Show »
Length:250
Mass (Da):28,110
Checksum:i25EBA2DE83E9EA87
GO
Isoform 4 (identifier: Q9QXA1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-311: CTNGHLMCAG...LRLFLFQIQK → SSRGAAAGFL...ALHTQRLQWE

Show »
Length:192
Mass (Da):20,156
Checksum:i6741B678DAAE7ABE
GO

Sequence cautioni

The sequence BAC97966 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0328211 – 37Missing in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0328221 – 30MVSKP…AVSSV → MSGAEEAGGGGPAAGPAGAV PAGVGVGAGPGAAAGPAAAA LGEAAGPGIPDEAALAGARQ LQEAAGDPDAPPKKRLRAAE AAEAAAAAVAAGSGKLEERL YSVLCCTVCLDLPKASVY in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03282332 – 311CTNGH…FQIQK → SSRGAAAGFLLQTFAAIIML APGPSTHEDCLAGAWVATVI GLPLLAFDFHWVNGDRSSAN LLLGGGMVLAVAGDHLGPEG CSVAGQAVLLVVAVTILIVA VFTANTYGMWGGTLLGVAGL LSRLEEDRLLLLPKEDVCRW ALAAGSWAYCRALHTQRLQW E in isoform 4. 2 PublicationsAdd BLAST280
Alternative sequenceiVSP_032824182 – 311EVQFR…FQIQK → VWVFGPYLWSTEQEEHSIKS DPVYRCSLKATEPPEAGKKL FGDRVPEQAEGLSSNCRTGN GCPQMSKLDQARPTGSHGSR ASVTSSEHVGEQEPGHTLGQ RTRSTC in isoform 2 and isoform 3. 2 PublicationsAdd BLAST130

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251516 mRNA Translation: CAB62575.1
AK129156 mRNA Translation: BAC97966.1 Different initiation.
AK004009 mRNA Translation: BAB23122.1
BC016196 mRNA Translation: AAH16196.1
BC025112 mRNA Translation: AAH25112.1
BC062184 mRNA Translation: AAH62184.1
BC082772 mRNA Translation: AAH82772.1
CCDSiCCDS27581.1 [Q9QXA1-1]
CCDS27582.1 [Q9QXA1-4]
RefSeqiNP_001263251.1, NM_001276322.1 [Q9QXA1-4]
NP_001263262.1, NM_001276333.1 [Q9QXA1-4]
NP_001263263.1, NM_001276334.1 [Q9QXA1-4]
NP_001263264.1, NM_001276335.1 [Q9QXA1-4]
NP_062269.1, NM_019396.3 [Q9QXA1-1]
NP_851293.1, NM_180962.2 [Q9QXA1-4]
XP_006521232.1, XM_006521169.3 [Q9QXA1-1]
UniGeneiMm.247752
Mm.392807
Mm.491122

Genome annotation databases

EnsembliENSMUST00000066677; ENSMUSP00000063317; ENSMUSG00000053929 [Q9QXA1-4]
ENSMUST00000081291; ENSMUSP00000080043; ENSMUSG00000053929 [Q9QXA1-1]
ENSMUST00000177359; ENSMUSP00000135505; ENSMUSG00000053929 [Q9QXA1-4]
GeneIDi54151
KEGGimmu:54151
UCSCiuc007wlf.2 mouse [Q9QXA1-1]
uc007wli.2 mouse [Q9QXA1-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCYHR1_MOUSE
AccessioniPrimary (citable) accession number: Q9QXA1
Secondary accession number(s): Q6P6J7, Q6ZQA2, Q9D134
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 1, 2000
Last modified: March 28, 2018
This is version 112 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health