Q9QX73 (ARHG9_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rho guanine nucleotide exchange factor 9 Alternative name(s): Collybistin Rac/Cdc42 guanine nucleotide exchange factor 9 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 493 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters. Ref.1 Ref.2 Ref.3 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle. Ref.1 |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 PH domain. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | SH3 domain |
| Molecular function | Guanine-nucleotide releasing factor |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | receptor clustering Inferred from direct assay Ref.1. Source: RGD regulation of Rho protein signal transductionInferred from electronic annotation. Source: InterPro |
| Cellular_component | cell cortex Inferred from direct assay Ref.1. Source: RGD |
| Molecular_function | Rho guanyl-nucleotide exchange factor activity Inferred from electronic annotation. Source: InterPro phospholipid bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9QX73-1) Also known as: Collybistin I; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9QX73-2) Also known as: Collybistin II; The sequence of this isoform differs from the canonical sequence as follows: 12-71: Missing. 464-493: GRVGEEENQSLELKRACEVLQRLWSPGKKS → VTQRKWHY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 493 | 493 | Rho guanine nucleotide exchange factor 9 | PRO_0000253898 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 15 – 74 | 60 | SH3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 110 – 294 | 185 | DH | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 325 – 432 | 108 | PH | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 107 – 117 | 11 | Interaction with GPHN | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 12 – 71 | 60 | Missing in isoform 2. | VSP_021147 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 464 – 493 | 30 | GRVGE…PGKKS → VTQRKWHY in isoform 2. | VSP_021148 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 107 | 1 | R → A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. Ref.2 Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 108 | 1 | D → A: No effect on GPHN clusters; when associated with A-107 and A-117. Ref.2 Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 111 | 1 | R → A: Loss of formation of GPHN clusters. Ref.2 Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 117 | 1 | E → A: No effect on GPHN clusters; when associated with A-107 and A-108. Ref.2 Ref.4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 107 – 135 | 29 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 137 – 142 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 144 – 146 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 149 – 156 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 159 – 176 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 184 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 188 – 193 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 194 – 196 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 197 – 199 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 200 – 218 | 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 222 – 234 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 246 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 248 – 265 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 274 – 299 | 26 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 301 – 310 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 319 – 321 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 326 – 337 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 343 – 350 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 353 – 359 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 374 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 375 – 377 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 378 – 382 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 385 – 387 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 389 – 391 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 394 – 407 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 409 – 413 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 417 – 440 | 24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 446 – 458 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Collybistin, a newly identified brain-specific GEF, induces submembrane clustering of gephyrin." Kins S., Betz H., Kirsch J. Nat. Neurosci. 3:22-29(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | "Identification of a gephyrin-binding motif in the GDP/GTP exchange factor collybistin." Grosskreutz Y., Hermann A., Kins S., Fuhrmann J.C., Betz H., Kneussel M. Biol. Chem. 382:1455-1462(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH GPHN, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117. |
| [3] | "The GDP-GTP exchange factor collybistin: an essential determinant of neuronal gephyrin clustering." Harvey K., Duguid I.C., Alldred M.J., Beatty S.E., Ward H., Keep N.H., Lingenfelter S.E., Pearce B.R., Lundgren J., Owen M.J., Smart T.G., Luescher B., Rees M.I., Harvey R.J. J. Neurosci. 24:5816-5826(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION. |
| [4] | "The crystal structure of Cdc42 in complex with collybistin II, a gephyrin-interacting guanine nucleotide exchange factor." Xiang S., Kim E.Y., Connelly J.J., Nassar N., Kirsch J., Winking J., Schwarz G., Schindelin H. J. Mol. Biol. 359:35-46(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 10-411 IN COMPLEX WITH CDC42, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AJ250425 mRNA. Translation: CAB65966.1. AJ302676 mRNA. Translation: CAC16410.1. | ||||||||||||
| IPI | IPI00212702. IPI00950669. | ||||||||||||
| RefSeq | NP_076447.1. NM_023957.1. | ||||||||||||
| UniGene | Rn.163449. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9QX73. | ||||||||||||
| SMR | Q9QX73. Positions 11-461. | ||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9QX73. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9QX73. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 66013. | ||||||||||||
| KEGG | rno:66013. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 23229. | ||||||||||||
| RGD | 620719. Arhgef9. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5422. | ||||||||||||
| HOGENOM | HOG000237363. | ||||||||||||
| HOVERGEN | HBG050568. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9QX73. | ||||||||||||
| Genevestigator | Q9QX73. | ||||||||||||
| GermOnline | ENSRNOG00000007733. Rattus norvegicus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.900.10. 1 hit. 2.30.29.30. 1 hit. | ||||||||||||
| InterPro | IPR000219. DH-domain. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00169. PH. 1 hit. PF00621. RhoGEF. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00233. PH. 1 hit. SM00325. RhoGEF. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF48065. DH-domain. 1 hit. SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS00741. DH_1. False negative. PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9QX73. | ||||||||||||
| NextBio | 614272. | ||||||||||||
Entry information
| Entry name | ARHG9_RAT | ||||||||
| Accession | Primary (citable) accession number: Q9QX73 Secondary accession number(s): Q9ER22 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
