Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QX73

- ARHG9_RAT

UniProt

Q9QX73 - ARHG9_RAT

Protein

Rho guanine nucleotide exchange factor 9

Gene

Arhgef9

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.3 Publications

    GO - Molecular functioni

    1. protein binding Source: RGD
    2. Rho guanyl-nucleotide exchange factor activity Source: InterPro

    GO - Biological processi

    1. receptor clustering Source: RGD

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rho guanine nucleotide exchange factor 9
    Alternative name(s):
    Collybistin
    Rac/Cdc42 guanine nucleotide exchange factor 9
    Gene namesi
    Name:Arhgef9
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi620719. Arhgef9.

    Subcellular locationi

    Cytoplasm 3 Publications

    GO - Cellular componenti

    1. cell cortex Source: RGD

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi107 – 1071R → A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. 2 Publications
    Mutagenesisi108 – 1081D → A: No effect on GPHN clusters; when associated with A-107 and A-117. 2 Publications
    Mutagenesisi111 – 1111R → A: Loss of formation of GPHN clusters. 2 Publications
    Mutagenesisi117 – 1171E → A: No effect on GPHN clusters; when associated with A-107 and A-108. 2 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 493493Rho guanine nucleotide exchange factor 9PRO_0000253898Add
    BLAST

    Proteomic databases

    PaxDbiQ9QX73.

    PTM databases

    PhosphoSiteiQ9QX73.

    Expressioni

    Tissue specificityi

    Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle.1 Publication

    Gene expression databases

    GenevestigatoriQ9QX73.

    Interactioni

    Subunit structurei

    Interacts with GPHN.4 Publications

    Structurei

    Secondary structure

    1
    493
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi107 – 13529
    Helixi137 – 1426
    Turni144 – 1463
    Helixi149 – 1568
    Helixi159 – 17618
    Helixi182 – 1843
    Helixi188 – 1936
    Turni194 – 1963
    Helixi197 – 1993
    Helixi200 – 21819
    Helixi222 – 23413
    Helixi242 – 2465
    Helixi248 – 26518
    Helixi274 – 29926
    Helixi301 – 31010
    Helixi319 – 3213
    Beta strandi326 – 33712
    Beta strandi343 – 3508
    Beta strandi353 – 3597
    Beta strandi367 – 3748
    Helixi375 – 3773
    Beta strandi378 – 3825
    Beta strandi385 – 3873
    Beta strandi389 – 3913
    Beta strandi394 – 40714
    Beta strandi409 – 4135
    Helixi417 – 44024
    Helixi446 – 45813

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DFKX-ray2.15A/C71-487[»]
    ProteinModelPortaliQ9QX73.
    SMRiQ9QX73. Positions 11-461.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9QX73.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini15 – 7460SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini110 – 294185DHPROSITE-ProRule annotationAdd
    BLAST
    Domaini325 – 432108PHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni107 – 11711Interaction with GPHNAdd
    BLAST

    Sequence similaritiesi

    Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH3 domain

    Phylogenomic databases

    eggNOGiCOG5422.
    HOGENOMiHOG000237363.
    HOVERGENiHBG050568.
    PhylomeDBiQ9QX73.

    Family and domain databases

    Gene3Di1.20.900.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR000219. DH-domain.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF00169. PH. 1 hit.
    PF00621. RhoGEF. 1 hit.
    PF14604. SH3_9. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00325. RhoGEF. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF48065. SSF48065. 1 hit.
    SSF50044. SSF50044. 1 hit.
    PROSITEiPS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9QX73-1) [UniParc]FASTAAdd to Basket

    Also known as: Collybistin I

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQWIRGGSGM LITGDSIVSA EAVWDHVTMA NRGVAFKAGD VIKVLDASNK    50
    DWWWGQIDDE EGWFPASFVR LWVNQEDGVE EGPSDVQNGH LDPNSDCLCL 100
    GRPLQNRDQM RANVINEIMS TERHYIKHLK DICEGYLKQC RKRRDMFSDE 150
    QLKVIFGNIE DIYRFQMGFV RDLEKQYNND DPHLSEIGPC FLEHQDGFWI 200
    YSEYCNNHLD ACMELSKLMK DSRYQHFFEA CRLLQQMIDI AIDGFLLTPV 250
    QKICKYPLQL AELLKYTAQD HSDYRYVAAA LAVMRNVTQQ INERKRRLEN 300
    IDKIAQWQAS VLDWEGDDIL DRSSELIYTG EMAWIYQPYG RNQQRVFFLF 350
    DHQMVLCKKD LIRRDILYYK GRIDMDKYEV IDIEDGRDDD FNVSMKNAFK 400
    LHNKETEEVH LFFAKKLEEK IRWLRAFREE RKMVQEDEKI GFEISENQKR 450
    QAAMTVRKAS KQKGRVGEEE NQSLELKRAC EVLQRLWSPG KKS 493
    Length:493
    Mass (Da):58,157
    Last modified:May 1, 2000 - v1
    Checksum:i41040671B9398BFA
    GO
    Isoform 2 (identifier: Q9QX73-2) [UniParc]FASTAAdd to Basket

    Also known as: Collybistin II

    The sequence of this isoform differs from the canonical sequence as follows:
         12-71: Missing.
         464-493: GRVGEEENQSLELKRACEVLQRLWSPGKKS → VTQRKWHY

    Show »
    Length:411
    Mass (Da):49,156
    Checksum:i4AFFE36CFEE5A820
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei12 – 7160Missing in isoform 2. 1 PublicationVSP_021147Add
    BLAST
    Alternative sequencei464 – 49330GRVGE…PGKKS → VTQRKWHY in isoform 2. 1 PublicationVSP_021148Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ250425 mRNA. Translation: CAB65966.1.
    AJ302676 mRNA. Translation: CAC16410.1.
    RefSeqiNP_076447.1. NM_023957.1. [Q9QX73-1]
    UniGeneiRn.163449.

    Genome annotation databases

    GeneIDi66013.
    KEGGirno:66013.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ250425 mRNA. Translation: CAB65966.1 .
    AJ302676 mRNA. Translation: CAC16410.1 .
    RefSeqi NP_076447.1. NM_023957.1. [Q9QX73-1 ]
    UniGenei Rn.163449.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DFK X-ray 2.15 A/C 71-487 [» ]
    ProteinModelPortali Q9QX73.
    SMRi Q9QX73. Positions 11-461.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q9QX73.

    Proteomic databases

    PaxDbi Q9QX73.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 66013.
    KEGGi rno:66013.

    Organism-specific databases

    CTDi 23229.
    RGDi 620719. Arhgef9.

    Phylogenomic databases

    eggNOGi COG5422.
    HOGENOMi HOG000237363.
    HOVERGENi HBG050568.
    PhylomeDBi Q9QX73.

    Miscellaneous databases

    EvolutionaryTracei Q9QX73.
    NextBioi 614272.

    Gene expression databases

    Genevestigatori Q9QX73.

    Family and domain databases

    Gene3Di 1.20.900.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR000219. DH-domain.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF00169. PH. 1 hit.
    PF00621. RhoGEF. 1 hit.
    PF14604. SH3_9. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00325. RhoGEF. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48065. SSF48065. 1 hit.
    SSF50044. SSF50044. 1 hit.
    PROSITEi PS50010. DH_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Collybistin, a newly identified brain-specific GEF, induces submembrane clustering of gephyrin."
      Kins S., Betz H., Kirsch J.
      Nat. Neurosci. 3:22-29(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Identification of a gephyrin-binding motif in the GDP/GTP exchange factor collybistin."
      Grosskreutz Y., Hermann A., Kins S., Fuhrmann J.C., Betz H., Kneussel M.
      Biol. Chem. 382:1455-1462(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH GPHN, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117.
    3. Cited for: ALTERNATIVE SPLICING, FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION.
    4. "The crystal structure of Cdc42 in complex with collybistin II, a gephyrin-interacting guanine nucleotide exchange factor."
      Xiang S., Kim E.Y., Connelly J.J., Nassar N., Kirsch J., Winking J., Schwarz G., Schindelin H.
      J. Mol. Biol. 359:35-46(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 10-411 IN COMPLEX WITH CDC42, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117.

    Entry informationi

    Entry nameiARHG9_RAT
    AccessioniPrimary (citable) accession number: Q9QX73
    Secondary accession number(s): Q9ER22
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 17, 2006
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 91 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3