Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho guanine nucleotide exchange factor 9

Gene

Arhgef9

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.3 Publications

GO - Molecular functioni

GO - Biological processi

  • receptor clustering Source: RGD
  • regulation of Rho protein signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 9
Alternative name(s):
Collybistin
Rac/Cdc42 guanine nucleotide exchange factor 9
Gene namesi
Name:Arhgef9
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi620719. Arhgef9.

Subcellular locationi

GO - Cellular componenti

  • cell cortex Source: RGD
  • plasma membrane Source: GOC
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi107R → A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. 2 Publications1
Mutagenesisi108D → A: No effect on GPHN clusters; when associated with A-107 and A-117. 2 Publications1
Mutagenesisi111R → A: Loss of formation of GPHN clusters. 2 Publications1
Mutagenesisi117E → A: No effect on GPHN clusters; when associated with A-107 and A-108. 2 Publications1
Mutagenesisi297R → H: Defects in binding to phosphatidylinositol-3-phosphate and in formation of GPHN clusters. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002538981 – 493Rho guanine nucleotide exchange factor 9Add BLAST493

Proteomic databases

PaxDbiQ9QX73.
PRIDEiQ9QX73.

PTM databases

PhosphoSitePlusiQ9QX73.

Expressioni

Tissue specificityi

Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle.1 Publication

Interactioni

Subunit structurei

Interacts with GPHN.4 Publications

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000061089.

Structurei

Secondary structure

1493
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi107 – 135Combined sources29
Helixi137 – 142Combined sources6
Turni144 – 146Combined sources3
Helixi149 – 156Combined sources8
Helixi159 – 176Combined sources18
Helixi182 – 184Combined sources3
Helixi188 – 193Combined sources6
Turni194 – 196Combined sources3
Helixi197 – 199Combined sources3
Helixi200 – 218Combined sources19
Helixi222 – 234Combined sources13
Helixi242 – 246Combined sources5
Helixi248 – 265Combined sources18
Helixi274 – 299Combined sources26
Helixi301 – 310Combined sources10
Beta strandi311 – 313Combined sources3
Helixi319 – 321Combined sources3
Beta strandi326 – 337Combined sources12
Beta strandi343 – 350Combined sources8
Beta strandi353 – 359Combined sources7
Beta strandi367 – 374Combined sources8
Helixi375 – 377Combined sources3
Beta strandi378 – 382Combined sources5
Beta strandi385 – 387Combined sources3
Beta strandi389 – 391Combined sources3
Beta strandi394 – 407Combined sources14
Beta strandi409 – 413Combined sources5
Helixi417 – 440Combined sources24
Helixi446 – 458Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DFKX-ray2.15A/C71-487[»]
4MT6X-ray5.50A1-456[»]
4MT7X-ray3.50A10-493[»]
ProteinModelPortaliQ9QX73.
SMRiQ9QX73.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9QX73.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini15 – 74SH3PROSITE-ProRule annotationAdd BLAST60
Domaini110 – 294DHPROSITE-ProRule annotationAdd BLAST185
Domaini325 – 432PHPROSITE-ProRule annotationAdd BLAST108

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni107 – 117Interaction with GPHNAdd BLAST11

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3519. Eukaryota.
ENOG410XT9S. LUCA.
HOGENOMiHOG000237363.
HOVERGENiHBG050568.
InParanoidiQ9QX73.
KOiK20686.
PhylomeDBiQ9QX73.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9QX73-1) [UniParc]FASTAAdd to basket
Also known as: Collybistin I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQWIRGGSGM LITGDSIVSA EAVWDHVTMA NRGVAFKAGD VIKVLDASNK
60 70 80 90 100
DWWWGQIDDE EGWFPASFVR LWVNQEDGVE EGPSDVQNGH LDPNSDCLCL
110 120 130 140 150
GRPLQNRDQM RANVINEIMS TERHYIKHLK DICEGYLKQC RKRRDMFSDE
160 170 180 190 200
QLKVIFGNIE DIYRFQMGFV RDLEKQYNND DPHLSEIGPC FLEHQDGFWI
210 220 230 240 250
YSEYCNNHLD ACMELSKLMK DSRYQHFFEA CRLLQQMIDI AIDGFLLTPV
260 270 280 290 300
QKICKYPLQL AELLKYTAQD HSDYRYVAAA LAVMRNVTQQ INERKRRLEN
310 320 330 340 350
IDKIAQWQAS VLDWEGDDIL DRSSELIYTG EMAWIYQPYG RNQQRVFFLF
360 370 380 390 400
DHQMVLCKKD LIRRDILYYK GRIDMDKYEV IDIEDGRDDD FNVSMKNAFK
410 420 430 440 450
LHNKETEEVH LFFAKKLEEK IRWLRAFREE RKMVQEDEKI GFEISENQKR
460 470 480 490
QAAMTVRKAS KQKGRVGEEE NQSLELKRAC EVLQRLWSPG KKS
Length:493
Mass (Da):58,157
Last modified:May 1, 2000 - v1
Checksum:i41040671B9398BFA
GO
Isoform 2 (identifier: Q9QX73-2) [UniParc]FASTAAdd to basket
Also known as: Collybistin II

The sequence of this isoform differs from the canonical sequence as follows:
     12-71: Missing.
     464-493: GRVGEEENQSLELKRACEVLQRLWSPGKKS → VTQRKWHY

Show »
Length:411
Mass (Da):49,156
Checksum:i4AFFE36CFEE5A820
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02114712 – 71Missing in isoform 2. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_021148464 – 493GRVGE…PGKKS → VTQRKWHY in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250425 mRNA. Translation: CAB65966.1.
AJ302676 mRNA. Translation: CAC16410.1.
RefSeqiNP_076447.1. NM_023957.1. [Q9QX73-1]
UniGeneiRn.163449.

Genome annotation databases

GeneIDi66013.
KEGGirno:66013.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250425 mRNA. Translation: CAB65966.1.
AJ302676 mRNA. Translation: CAC16410.1.
RefSeqiNP_076447.1. NM_023957.1. [Q9QX73-1]
UniGeneiRn.163449.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DFKX-ray2.15A/C71-487[»]
4MT6X-ray5.50A1-456[»]
4MT7X-ray3.50A10-493[»]
ProteinModelPortaliQ9QX73.
SMRiQ9QX73.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000061089.

PTM databases

PhosphoSitePlusiQ9QX73.

Proteomic databases

PaxDbiQ9QX73.
PRIDEiQ9QX73.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi66013.
KEGGirno:66013.

Organism-specific databases

CTDi23229.
RGDi620719. Arhgef9.

Phylogenomic databases

eggNOGiKOG3519. Eukaryota.
ENOG410XT9S. LUCA.
HOGENOMiHOG000237363.
HOVERGENiHBG050568.
InParanoidiQ9QX73.
KOiK20686.
PhylomeDBiQ9QX73.

Miscellaneous databases

EvolutionaryTraceiQ9QX73.
PROiQ9QX73.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARHG9_RAT
AccessioniPrimary (citable) accession number: Q9QX73
Secondary accession number(s): Q9ER22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: May 1, 2000
Last modified: November 2, 2016
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.