Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QX73

- ARHG9_RAT

UniProt

Q9QX73 - ARHG9_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Rho guanine nucleotide exchange factor 9

Gene

Arhgef9

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.3 Publications

GO - Molecular functioni

  1. Rho guanyl-nucleotide exchange factor activity Source: InterPro

GO - Biological processi

  1. receptor clustering Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 9
Alternative name(s):
Collybistin
Rac/Cdc42 guanine nucleotide exchange factor 9
Gene namesi
Name:Arhgef9
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi620719. Arhgef9.

Subcellular locationi

Cytoplasm 3 Publications

GO - Cellular componenti

  1. cell cortex Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi107 – 1071R → A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. 2 Publications
Mutagenesisi108 – 1081D → A: No effect on GPHN clusters; when associated with A-107 and A-117. 2 Publications
Mutagenesisi111 – 1111R → A: Loss of formation of GPHN clusters. 2 Publications
Mutagenesisi117 – 1171E → A: No effect on GPHN clusters; when associated with A-107 and A-108. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 493493Rho guanine nucleotide exchange factor 9PRO_0000253898Add
BLAST

Proteomic databases

PaxDbiQ9QX73.

PTM databases

PhosphoSiteiQ9QX73.

Expressioni

Tissue specificityi

Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle.1 Publication

Gene expression databases

GenevestigatoriQ9QX73.

Interactioni

Subunit structurei

Interacts with GPHN.4 Publications

Structurei

Secondary structure

1
493
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi107 – 13529Combined sources
Helixi137 – 1426Combined sources
Turni144 – 1463Combined sources
Helixi149 – 1568Combined sources
Helixi159 – 17618Combined sources
Helixi182 – 1843Combined sources
Helixi188 – 1936Combined sources
Turni194 – 1963Combined sources
Helixi197 – 1993Combined sources
Helixi200 – 21819Combined sources
Helixi222 – 23413Combined sources
Helixi242 – 2465Combined sources
Helixi248 – 26518Combined sources
Helixi274 – 29926Combined sources
Helixi301 – 31010Combined sources
Beta strandi311 – 3133Combined sources
Helixi319 – 3213Combined sources
Beta strandi326 – 33712Combined sources
Beta strandi343 – 3508Combined sources
Beta strandi353 – 3597Combined sources
Beta strandi367 – 3748Combined sources
Helixi375 – 3773Combined sources
Beta strandi378 – 3825Combined sources
Beta strandi385 – 3873Combined sources
Beta strandi389 – 3913Combined sources
Beta strandi394 – 40714Combined sources
Beta strandi409 – 4135Combined sources
Helixi417 – 44024Combined sources
Helixi446 – 45813Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DFKX-ray2.15A/C71-487[»]
4MT6X-ray5.50A1-456[»]
4MT7X-ray3.50A10-493[»]
ProteinModelPortaliQ9QX73.
SMRiQ9QX73. Positions 11-461.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9QX73.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 7460SH3PROSITE-ProRule annotationAdd
BLAST
Domaini110 – 294185DHPROSITE-ProRule annotationAdd
BLAST
Domaini325 – 432108PHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni107 – 11711Interaction with GPHNAdd
BLAST

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiCOG5422.
HOGENOMiHOG000237363.
HOVERGENiHBG050568.
InParanoidiQ9QX73.
PhylomeDBiQ9QX73.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9QX73-1) [UniParc]FASTAAdd to Basket

Also known as: Collybistin I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQWIRGGSGM LITGDSIVSA EAVWDHVTMA NRGVAFKAGD VIKVLDASNK
60 70 80 90 100
DWWWGQIDDE EGWFPASFVR LWVNQEDGVE EGPSDVQNGH LDPNSDCLCL
110 120 130 140 150
GRPLQNRDQM RANVINEIMS TERHYIKHLK DICEGYLKQC RKRRDMFSDE
160 170 180 190 200
QLKVIFGNIE DIYRFQMGFV RDLEKQYNND DPHLSEIGPC FLEHQDGFWI
210 220 230 240 250
YSEYCNNHLD ACMELSKLMK DSRYQHFFEA CRLLQQMIDI AIDGFLLTPV
260 270 280 290 300
QKICKYPLQL AELLKYTAQD HSDYRYVAAA LAVMRNVTQQ INERKRRLEN
310 320 330 340 350
IDKIAQWQAS VLDWEGDDIL DRSSELIYTG EMAWIYQPYG RNQQRVFFLF
360 370 380 390 400
DHQMVLCKKD LIRRDILYYK GRIDMDKYEV IDIEDGRDDD FNVSMKNAFK
410 420 430 440 450
LHNKETEEVH LFFAKKLEEK IRWLRAFREE RKMVQEDEKI GFEISENQKR
460 470 480 490
QAAMTVRKAS KQKGRVGEEE NQSLELKRAC EVLQRLWSPG KKS
Length:493
Mass (Da):58,157
Last modified:May 1, 2000 - v1
Checksum:i41040671B9398BFA
GO
Isoform 2 (identifier: Q9QX73-2) [UniParc]FASTAAdd to Basket

Also known as: Collybistin II

The sequence of this isoform differs from the canonical sequence as follows:
     12-71: Missing.
     464-493: GRVGEEENQSLELKRACEVLQRLWSPGKKS → VTQRKWHY

Show »
Length:411
Mass (Da):49,156
Checksum:i4AFFE36CFEE5A820
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei12 – 7160Missing in isoform 2. 1 PublicationVSP_021147Add
BLAST
Alternative sequencei464 – 49330GRVGE…PGKKS → VTQRKWHY in isoform 2. 1 PublicationVSP_021148Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250425 mRNA. Translation: CAB65966.1.
AJ302676 mRNA. Translation: CAC16410.1.
RefSeqiNP_076447.1. NM_023957.1. [Q9QX73-1]
UniGeneiRn.163449.

Genome annotation databases

GeneIDi66013.
KEGGirno:66013.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ250425 mRNA. Translation: CAB65966.1 .
AJ302676 mRNA. Translation: CAC16410.1 .
RefSeqi NP_076447.1. NM_023957.1. [Q9QX73-1 ]
UniGenei Rn.163449.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2DFK X-ray 2.15 A/C 71-487 [» ]
4MT6 X-ray 5.50 A 1-456 [» ]
4MT7 X-ray 3.50 A 10-493 [» ]
ProteinModelPortali Q9QX73.
SMRi Q9QX73. Positions 11-461.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q9QX73.

Proteomic databases

PaxDbi Q9QX73.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 66013.
KEGGi rno:66013.

Organism-specific databases

CTDi 23229.
RGDi 620719. Arhgef9.

Phylogenomic databases

eggNOGi COG5422.
HOGENOMi HOG000237363.
HOVERGENi HBG050568.
InParanoidi Q9QX73.
PhylomeDBi Q9QX73.

Miscellaneous databases

EvolutionaryTracei Q9QX73.
NextBioi 614272.

Gene expression databases

Genevestigatori Q9QX73.

Family and domain databases

Gene3Di 1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Collybistin, a newly identified brain-specific GEF, induces submembrane clustering of gephyrin."
    Kins S., Betz H., Kirsch J.
    Nat. Neurosci. 3:22-29(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Identification of a gephyrin-binding motif in the GDP/GTP exchange factor collybistin."
    Grosskreutz Y., Hermann A., Kins S., Fuhrmann J.C., Betz H., Kneussel M.
    Biol. Chem. 382:1455-1462(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH GPHN, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117.
  3. Cited for: ALTERNATIVE SPLICING, FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION.
  4. "The crystal structure of Cdc42 in complex with collybistin II, a gephyrin-interacting guanine nucleotide exchange factor."
    Xiang S., Kim E.Y., Connelly J.J., Nassar N., Kirsch J., Winking J., Schwarz G., Schindelin H.
    J. Mol. Biol. 359:35-46(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 10-411 IN COMPLEX WITH CDC42, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117.

Entry informationi

Entry nameiARHG9_RAT
AccessioniPrimary (citable) accession number: Q9QX73
Secondary accession number(s): Q9ER22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: May 1, 2000
Last modified: November 26, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3