SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QX73

- ARHG9_RAT

UniProt

Q9QX73 - ARHG9_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Rho guanine nucleotide exchange factor 9
Gene
Arhgef9
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters.3 Publications

GO - Molecular functioni

  1. Rho guanyl-nucleotide exchange factor activity Source: InterPro
  2. protein binding Source: RGD

GO - Biological processi

  1. receptor clustering Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 9
Alternative name(s):
Collybistin
Rac/Cdc42 guanine nucleotide exchange factor 9
Gene namesi
Name:Arhgef9
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi620719. Arhgef9.

Subcellular locationi

Cytoplasm 3 Publications

GO - Cellular componenti

  1. cell cortex Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi107 – 1071R → A: No effect on formation of GPHN clusters; when associated with A-108 and A-117. 2 Publications
Mutagenesisi108 – 1081D → A: No effect on GPHN clusters; when associated with A-107 and A-117. 2 Publications
Mutagenesisi111 – 1111R → A: Loss of formation of GPHN clusters. 2 Publications
Mutagenesisi117 – 1171E → A: No effect on GPHN clusters; when associated with A-107 and A-108. 2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 493493Rho guanine nucleotide exchange factor 9
PRO_0000253898Add
BLAST

Proteomic databases

PaxDbiQ9QX73.

PTM databases

PhosphoSiteiQ9QX73.

Expressioni

Tissue specificityi

Detected in brain, throughout the gray matter. Detected at low levels in heart and skeletal muscle.1 Publication

Gene expression databases

GenevestigatoriQ9QX73.

Interactioni

Subunit structurei

Interacts with GPHN.3 Publications

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi107 – 13529
Helixi137 – 1426
Turni144 – 1463
Helixi149 – 1568
Helixi159 – 17618
Helixi182 – 1843
Helixi188 – 1936
Turni194 – 1963
Helixi197 – 1993
Helixi200 – 21819
Helixi222 – 23413
Helixi242 – 2465
Helixi248 – 26518
Helixi274 – 29926
Helixi301 – 31010
Helixi319 – 3213
Beta strandi326 – 33712
Beta strandi343 – 3508
Beta strandi353 – 3597
Beta strandi367 – 3748
Helixi375 – 3773
Beta strandi378 – 3825
Beta strandi385 – 3873
Beta strandi389 – 3913
Beta strandi394 – 40714
Beta strandi409 – 4135
Helixi417 – 44024
Helixi446 – 45813

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DFKX-ray2.15A/C71-487[»]
ProteinModelPortaliQ9QX73.
SMRiQ9QX73. Positions 11-461.

Miscellaneous databases

EvolutionaryTraceiQ9QX73.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 7460SH3
Add
BLAST
Domaini110 – 294185DH
Add
BLAST
Domaini325 – 432108PH
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni107 – 11711Interaction with GPHN
Add
BLAST

Sequence similaritiesi

Contains 1 PH domain.
Contains 1 SH3 domain.

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiCOG5422.
HOGENOMiHOG000237363.
HOVERGENiHBG050568.
PhylomeDBiQ9QX73.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9QX73-1) [UniParc]FASTAAdd to Basket

Also known as: Collybistin I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQWIRGGSGM LITGDSIVSA EAVWDHVTMA NRGVAFKAGD VIKVLDASNK    50
DWWWGQIDDE EGWFPASFVR LWVNQEDGVE EGPSDVQNGH LDPNSDCLCL 100
GRPLQNRDQM RANVINEIMS TERHYIKHLK DICEGYLKQC RKRRDMFSDE 150
QLKVIFGNIE DIYRFQMGFV RDLEKQYNND DPHLSEIGPC FLEHQDGFWI 200
YSEYCNNHLD ACMELSKLMK DSRYQHFFEA CRLLQQMIDI AIDGFLLTPV 250
QKICKYPLQL AELLKYTAQD HSDYRYVAAA LAVMRNVTQQ INERKRRLEN 300
IDKIAQWQAS VLDWEGDDIL DRSSELIYTG EMAWIYQPYG RNQQRVFFLF 350
DHQMVLCKKD LIRRDILYYK GRIDMDKYEV IDIEDGRDDD FNVSMKNAFK 400
LHNKETEEVH LFFAKKLEEK IRWLRAFREE RKMVQEDEKI GFEISENQKR 450
QAAMTVRKAS KQKGRVGEEE NQSLELKRAC EVLQRLWSPG KKS 493
Length:493
Mass (Da):58,157
Last modified:May 1, 2000 - v1
Checksum:i41040671B9398BFA
GO
Isoform 2 (identifier: Q9QX73-2) [UniParc]FASTAAdd to Basket

Also known as: Collybistin II

The sequence of this isoform differs from the canonical sequence as follows:
     12-71: Missing.
     464-493: GRVGEEENQSLELKRACEVLQRLWSPGKKS → VTQRKWHY

Show »
Length:411
Mass (Da):49,156
Checksum:i4AFFE36CFEE5A820
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei12 – 7160Missing in isoform 2.
VSP_021147Add
BLAST
Alternative sequencei464 – 49330GRVGE…PGKKS → VTQRKWHY in isoform 2.
VSP_021148Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ250425 mRNA. Translation: CAB65966.1.
AJ302676 mRNA. Translation: CAC16410.1.
RefSeqiNP_076447.1. NM_023957.1. [Q9QX73-1]
UniGeneiRn.163449.

Genome annotation databases

GeneIDi66013.
KEGGirno:66013.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ250425 mRNA. Translation: CAB65966.1 .
AJ302676 mRNA. Translation: CAC16410.1 .
RefSeqi NP_076447.1. NM_023957.1. [Q9QX73-1 ]
UniGenei Rn.163449.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2DFK X-ray 2.15 A/C 71-487 [» ]
ProteinModelPortali Q9QX73.
SMRi Q9QX73. Positions 11-461.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q9QX73.

Proteomic databases

PaxDbi Q9QX73.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 66013.
KEGGi rno:66013.

Organism-specific databases

CTDi 23229.
RGDi 620719. Arhgef9.

Phylogenomic databases

eggNOGi COG5422.
HOGENOMi HOG000237363.
HOVERGENi HBG050568.
PhylomeDBi Q9QX73.

Miscellaneous databases

EvolutionaryTracei Q9QX73.
NextBioi 614272.

Gene expression databases

Genevestigatori Q9QX73.

Family and domain databases

Gene3Di 1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR000219. DH-domain.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
PF14604. SH3_9. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF48065. SSF48065. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Collybistin, a newly identified brain-specific GEF, induces submembrane clustering of gephyrin."
    Kins S., Betz H., Kirsch J.
    Nat. Neurosci. 3:22-29(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Identification of a gephyrin-binding motif in the GDP/GTP exchange factor collybistin."
    Grosskreutz Y., Hermann A., Kins S., Fuhrmann J.C., Betz H., Kneussel M.
    Biol. Chem. 382:1455-1462(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH GPHN, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117.
  3. Cited for: ALTERNATIVE SPLICING, FUNCTION, INTERACTION WITH GPHN, SUBCELLULAR LOCATION.
  4. "The crystal structure of Cdc42 in complex with collybistin II, a gephyrin-interacting guanine nucleotide exchange factor."
    Xiang S., Kim E.Y., Connelly J.J., Nassar N., Kirsch J., Winking J., Schwarz G., Schindelin H.
    J. Mol. Biol. 359:35-46(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 10-411 IN COMPLEX WITH CDC42, MUTAGENESIS OF ARG-107; ASP-108; ARG-111 AND GLU-117.

Entry informationi

Entry nameiARHG9_RAT
AccessioniPrimary (citable) accession number: Q9QX73
Secondary accession number(s): Q9ER22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: May 1, 2000
Last modified: September 3, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3