Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QWI6

- SRCN1_MOUSE

UniProt

Q9QWI6 - SRCN1_MOUSE

Protein

SRC kinase signaling inhibitor 1

Gene

Srcin1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 104 (01 Oct 2014)
      Sequence version 2 (16 Jan 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. protein kinase binding Source: UniProtKB

    GO - Biological processi

    1. exocytosis Source: UniProtKB-KW
    2. negative regulation of cell adhesion Source: MGI
    3. negative regulation of protein tyrosine kinase activity Source: UniProtKB
    4. positive regulation of protein tyrosine kinase activity Source: UniProtKB
    5. regulation of cell migration Source: UniProtKB
    6. regulation of dendritic spine morphogenesis Source: UniProtKB
    7. substrate adhesion-dependent cell spreading Source: UniProtKB

    Keywords - Biological processi

    Exocytosis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    SRC kinase signaling inhibitor 1
    Alternative name(s):
    SNAP-25-interacting protein
    Short name:
    SNIP
    p130Cas-associated protein
    p140Cap
    Gene namesi
    Name:Srcin1
    Synonyms:Kiaa1684, P140
    OrganismiMus musculus (Mouse)Imported
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:1933179. Srcin1.

    Subcellular locationi

    Cytoplasm By similarity. Cytoplasmcytoskeleton By similarity. Cell projectionaxon By similarity. Cell projectiondendrite By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity
    Note: Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions By similarity.By similarity

    GO - Cellular componenti

    1. actin cytoskeleton Source: MGI
    2. axon Source: UniProtKB
    3. cell junction Source: UniProtKB-KW
    4. cytoplasm Source: UniProtKB
    5. dendrite Source: UniProtKB
    6. postsynaptic density Source: UniProtKB
    7. postsynaptic membrane Source: UniProtKB-KW
    8. synapse Source: UniProtKB

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12501250SRC kinase signaling inhibitor 1PRO_0000072012Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei309 – 3091Phosphotyrosine1 Publication
    Modified residuei411 – 4111Phosphoserine1 Publication
    Modified residuei464 – 4641Phosphotyrosine1 Publication
    Modified residuei588 – 5881Phosphoserine1 Publication
    Modified residuei974 – 9741Phosphoserine
    Modified residuei1054 – 10541Phosphoserine1 Publication
    Modified residuei1110 – 11101Phosphoserine1 Publication

    Post-translational modificationi

    Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9QWI6.
    PaxDbiQ9QWI6.
    PRIDEiQ9QWI6.

    PTM databases

    PhosphoSiteiQ9QWI6.

    Expressioni

    Tissue specificityi

    Expressed predominantly in central nervous system with high levels detected in cortex, cerebellum, midbrain and spinal cord (at protein level). Also expressed in testis and epithelial-rich tissues such as mammary gland, lung and kidney.2 Publications

    Gene expression databases

    GenevestigatoriQ9QWI6.

    Interactioni

    Subunit structurei

    Interacts with the N-terminal coiled-coil region of SNAP25. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BCAR1P569453EBI-775592,EBI-702093From a different organism.
    Bcar1Q611402EBI-775592,EBI-77088
    CTTNQ142472EBI-775607,EBI-351886From a different organism.
    MAPRE3Q9UPY85EBI-775607,EBI-726739From a different organism.
    SORBS3O60504-24EBI-775607,EBI-1222956From a different organism.
    SRCP005232EBI-775607,EBI-848039From a different organism.
    SypP078252EBI-775607,EBI-976085From a different organism.

    Protein-protein interaction databases

    BioGridi207768. 2 interactions.
    IntActiQ9QWI6. 21 interactions.
    MINTiMINT-4135063.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QWI6.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni681 – 73151Interaction with SNAP25By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili627 – 65428Sequence AnalysisAdd
    BLAST
    Coiled coili716 – 74126Sequence AnalysisAdd
    BLAST
    Coiled coili783 – 84563Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1023 – 108159Pro-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SRCIN1 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG69680.
    HOGENOMiHOG000293351.
    HOVERGENiHBG019587.
    InParanoidiQ9QWI6.
    PhylomeDBiQ9QWI6.

    Family and domain databases

    InterProiIPR026727. Srcin1.
    [Graphical view]
    PANTHERiPTHR22741:SF5. PTHR22741:SF5. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q9QWI6-1) [UniParc]FASTAAdd to Basket

    Also known as: 1a1 Publication

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQPWQCLRRF ALAWWERTAE GRARSPREEV GPRDPGGRGE PDPERSSPPM     50
    LSADDAEYPR EYRTLGGGGG GGSGGRRFSN VGLVHTSERR HTVIAAQSLE 100
    ALSGLQKADA DRKRDAFMDH LKSKYPQHAL ALRGQQDRMR EQVGGWTVDP 150
    VCLLSSLCSH LHGDSTPSGA GQPAQQPNYW SFKTRSSRHT QGAQPGLADQ 200
    AAKLSYASAE SLETMSEAEL PLGFSRMNRF RQSLPLSRSA SQTKLRSPGV 250
    LFLQFGEETR RVHITHEVSS LDTLHALIAH MFPQKLTMGM LKSPNTAILI 300
    KDEARNVFYE LEDVRDIQDR SIIKIYRKEP LYAAFPGSHL TNGDLRREMV 350
    YASRESSPTR RLNNLSPASH LASSSPPPGL PSGLPSGLPS GSPSRSRLSY 400
    AGGRPPSYAG SPVHHAAERL GGAPTGQGVS PSPSAILERR DVKPDEDLAG 450
    KAGGMVLVKG EGLYADPYGL LHEGRLSLAA AAETHSHTRA RAACTSGVPC 500
    ALSAPTPLPR CSPTWRTRCT RRALAALYGD GYGFRLPPSS PQKLADVSAP 550
    SGGPPPPHSP YSGPPSRGSP VRQSFRKDSG SSSVFAESPG GKARSTGSAS 600
    TAGAPPSELF PGPGERSLVG FGPPVPAKDT ETRERMEAME KQIASLTGLV 650
    QSALLRGSEP ETPSEKVEGS NGAATPSAPV CGSGSKSSGA TPVSGPPPPS 700
    ASSTPAGQPT AVSRLQMQLH LRGLQNSASD LRGQLQQLRN VQLQNQESVR 750
    ALLKPTEADV SMRVSEAARR QEDPLQRQRT LVEEERLRYL NDEELITQQL 800
    NDLEKSVEKI QRDVAHNHRL MPGPELEEKA LVLKQLGETL TELKAHFPGL 850
    QSKMRVVLRV EVEAVKFLKE EPQRLDGLLK RCRGVTDTLA QIRRQVDEGM 900
    WPPPNNLLNQ SPKKVAAETD FSKGLDFEIP PPSPPLNLHE LSGPAEGTPL 950
    TPKSTNPTKC LDASSKRNTD KAVSVEAAER DWEEKRAALT QYSAKDINRL 1000
    LEETQAELLK AIPDLDCASK THPGPAPTPD HKPPKAPHGQ KAAPRTEPSG 1050
    RRGSDELTVP RYRTEKPSKS PPPPPPRRSF PSSHGLTTTR TGEVVVTSKK 1100
    DSVFIKKAES EELEVQKPQV KLRRAVSEVV RPASTPPIMA SAIKDEDDEE 1150
    RIIAELESGG SSVPPMKVVT PGASRLKAAQ GPAGSPDKGK HGKQRTEYMR 1200
    IQAQQQATKP SKEVSGPNET SSPGSEKPSG SRTSIPVLTS FGARNSSISF 1250
    Length:1,250
    Mass (Da):134,859
    Last modified:January 16, 2004 - v2
    Checksum:i85F394C9523F78C0
    GO
    Isoform 21 Publication (identifier: Q9QWI6-2) [UniParc]FASTAAdd to Basket

    Also known as: 1b1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MQPWQCLRRFALAWWERTAEGRARSPREEVGPRDPGGRGEP → MGNAPSQ

    Show »
    Length:1,216
    Mass (Da):130,769
    Checksum:i67E3F46F8DB2BF60
    GO
    Isoform 3Curated (identifier: Q9QWI6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1207-1250: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,206
    Mass (Da):130,409
    Checksum:i0C3CDFB50C28B195
    GO

    Sequence cautioni

    The sequence BAC98232.1 differs from that shown. Reason: Frameshift at positions 483 and 527.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti740 – 7412NV → KL in BAC98232. (PubMed:14621295)Curated
    Sequence conflicti755 – 7551P → R in BAC98232. (PubMed:14621295)Curated
    Sequence conflicti759 – 7602DV → EL in BAC98232. (PubMed:14621295)Curated
    Sequence conflicti821 – 8211M → V in BAC98232. (PubMed:14621295)Curated
    Sequence conflicti960 – 9601C → G in BAC98232. (PubMed:14621295)Curated
    Sequence conflicti1121 – 11222KL → NV in AAD00087. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4141MQPWQ…GRGEP → MGNAPSQ in isoform 2. 2 PublicationsVSP_050631Add
    BLAST
    Alternative sequencei1207 – 125044Missing in isoform 3. 1 PublicationVSP_050632Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF040944 mRNA. Translation: AAC15635.1.
    U59873 mRNA. Translation: AAD00087.1.
    AK129422 mRNA. Translation: BAC98232.1. Frameshift.
    PIRiT34101.
    RefSeqiNP_061361.2. NM_018873.2.
    UniGeneiMm.342665.

    Genome annotation databases

    GeneIDi56013.
    KEGGimmu:56013.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF040944 mRNA. Translation: AAC15635.1 .
    U59873 mRNA. Translation: AAD00087.1 .
    AK129422 mRNA. Translation: BAC98232.1 . Frameshift.
    PIRi T34101.
    RefSeqi NP_061361.2. NM_018873.2.
    UniGenei Mm.342665.

    3D structure databases

    ProteinModelPortali Q9QWI6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 207768. 2 interactions.
    IntActi Q9QWI6. 21 interactions.
    MINTi MINT-4135063.

    PTM databases

    PhosphoSitei Q9QWI6.

    Proteomic databases

    MaxQBi Q9QWI6.
    PaxDbi Q9QWI6.
    PRIDEi Q9QWI6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 56013.
    KEGGi mmu:56013.

    Organism-specific databases

    CTDi 80725.
    MGIi MGI:1933179. Srcin1.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG69680.
    HOGENOMi HOG000293351.
    HOVERGENi HBG019587.
    InParanoidi Q9QWI6.
    PhylomeDBi Q9QWI6.

    Miscellaneous databases

    ChiTaRSi SRCIN1. mouse.
    NextBioi 311742.
    PROi Q9QWI6.
    SOURCEi Search...

    Gene expression databases

    Genevestigatori Q9QWI6.

    Family and domain databases

    InterProi IPR026727. Srcin1.
    [Graphical view ]
    PANTHERi PTHR22741:SF5. PTHR22741:SF5. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Croci L., Bossolasco M., Consalez G.G.
      Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
      DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 271-1250 (ISOFORM 3).
      Tissue: BrainImported.
    3. "p130Cas-associated protein (p140Cap) as a new tyrosine-phosphorylated protein involved in cell spreading."
      Di Stefano P., Cabodi S., Erba E.B., Margaria V., Bergatto E., Giuffrida M.G., Silengo L., Tarone G., Turco E., Defilippi P.
      Mol. Biol. Cell 15:787-800(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic brain.
    5. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411; SER-588; SER-1054 AND SER-1110, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    6. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
      Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
      Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain cortex.
    7. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
      Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
      J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-309 AND TYR-464, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    8. Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiSRCN1_MOUSE
    AccessioniPrimary (citable) accession number: Q9QWI6
    Secondary accession number(s): O70298
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 16, 2004
    Last sequence update: January 16, 2004
    Last modified: October 1, 2014
    This is version 104 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3