Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QWI6 (SRCN1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
SRC kinase signaling inhibitor 1
Alternative name(s):
SNAP-25-interacting protein
Short name=SNIP
p130Cas-associated protein
p140Cap
Gene names
Name:Srcin1
Synonyms:Kiaa1684, P140
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1250 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance By similarity.

Subunit structure

Interacts with the N-terminal coiled-coil region of SNAP25. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3 By similarity.

Subcellular location

Cytoplasm By similarity. Cytoplasmcytoskeleton By similarity. Cell projectionaxon By similarity. Cell projectiondendrite By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Note: Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions By similarity.

Tissue specificity

Expressed predominantly in central nervous system with high levels detected in cortex, cerebellum, midbrain and spinal cord (at protein level). Also expressed in testis and epithelial-rich tissues such as mammary gland, lung and kidney. Ref.3 Ref.8

Post-translational modification

Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands By similarity. UniProtKB Q9C0H9

Sequence similarities

Belongs to the SRCIN1 family.

Sequence caution

The sequence BAC98232.1 differs from that shown. Reason: Frameshift at positions 483 and 527.

Ontologies

Keywords
   Biological processExocytosis
   Cellular componentCell junction
Cell membrane
Cell projection
Cytoplasm
Cytoskeleton
Membrane
Postsynaptic cell membrane
Synapse
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processexocytosis

Inferred from electronic annotation. Source: UniProtKB-KW

negative regulation of cell adhesion

Inferred from direct assay Ref.3. Source: MGI

negative regulation of protein tyrosine kinase activity

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of protein tyrosine kinase activity

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of cell migration

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of dendritic spine morphogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

substrate adhesion-dependent cell spreading

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentactin cytoskeleton

Inferred from sequence alignment Ref.3. Source: MGI

axon

Inferred from sequence or structural similarity. Source: UniProtKB

cell junction

Inferred from electronic annotation. Source: UniProtKB-KW

cytoplasm

Inferred from sequence or structural similarity. Source: UniProtKB

dendrite

Inferred from sequence or structural similarity. Source: UniProtKB

postsynaptic density

Inferred from sequence or structural similarity. Source: UniProtKB

postsynaptic membrane

Inferred from electronic annotation. Source: UniProtKB-KW

synapse

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionprotein binding

Inferred from physical interaction Ref.3Ref.8PubMed 17525734PubMed 18662323. Source: IntAct

protein kinase binding

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

BCAR1P569453EBI-775592,EBI-702093From a different organism.
Bcar1Q611402EBI-775592,EBI-77088
CTTNQ142472EBI-775607,EBI-351886From a different organism.
MAPRE3Q9UPY85EBI-775607,EBI-726739From a different organism.
SORBS3O60504-24EBI-775607,EBI-1222956From a different organism.
SRCP005232EBI-775607,EBI-848039From a different organism.
SypP078252EBI-775607,EBI-976085From a different organism.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.3 (identifier: Q9QWI6-1)

Also known as: 1a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 Ref.3 (identifier: Q9QWI6-2)

Also known as: 1b;

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MQPWQCLRRFALAWWERTAEGRARSPREEVGPRDPGGRGEP → MGNAPSQ
Isoform 3 (identifier: Q9QWI6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1207-1250: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12501250SRC kinase signaling inhibitor 1
PRO_0000072012

Regions

Region681 – 73151Interaction with SNAP25 By similarity
Coiled coil627 – 65428 Potential
Coiled coil716 – 74126 Potential
Coiled coil783 – 84563 Potential
Compositional bias1023 – 108159Pro-rich

Amino acid modifications

Modified residue3091Phosphotyrosine Ref.7
Modified residue4111Phosphoserine Ref.5
Modified residue4641Phosphotyrosine Ref.7
Modified residue5881Phosphoserine Ref.5
Modified residue9741Phosphoserine
Modified residue10541Phosphoserine Ref.5
Modified residue11101Phosphoserine Ref.5

Natural variations

Alternative sequence1 – 4141MQPWQ…GRGEP → MGNAPSQ in isoform 2. Ref.3
VSP_050631
Alternative sequence1207 – 125044Missing in isoform 3.
VSP_050632

Experimental info

Sequence conflict740 – 7412NV → KL in BAC98232. Ref.2
Sequence conflict7551P → R in BAC98232. Ref.2
Sequence conflict759 – 7602DV → EL in BAC98232. Ref.2
Sequence conflict8211M → V in BAC98232. Ref.2
Sequence conflict9601C → G in BAC98232. Ref.2
Sequence conflict1121 – 11222KL → NV in AAD00087. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (1a) [UniParc].

Last modified January 16, 2004. Version 2.
Checksum: 85F394C9523F78C0

FASTA1,250134,859
        10         20         30         40         50         60 
MQPWQCLRRF ALAWWERTAE GRARSPREEV GPRDPGGRGE PDPERSSPPM LSADDAEYPR 

        70         80         90        100        110        120 
EYRTLGGGGG GGSGGRRFSN VGLVHTSERR HTVIAAQSLE ALSGLQKADA DRKRDAFMDH 

       130        140        150        160        170        180 
LKSKYPQHAL ALRGQQDRMR EQVGGWTVDP VCLLSSLCSH LHGDSTPSGA GQPAQQPNYW 

       190        200        210        220        230        240 
SFKTRSSRHT QGAQPGLADQ AAKLSYASAE SLETMSEAEL PLGFSRMNRF RQSLPLSRSA 

       250        260        270        280        290        300 
SQTKLRSPGV LFLQFGEETR RVHITHEVSS LDTLHALIAH MFPQKLTMGM LKSPNTAILI 

       310        320        330        340        350        360 
KDEARNVFYE LEDVRDIQDR SIIKIYRKEP LYAAFPGSHL TNGDLRREMV YASRESSPTR 

       370        380        390        400        410        420 
RLNNLSPASH LASSSPPPGL PSGLPSGLPS GSPSRSRLSY AGGRPPSYAG SPVHHAAERL 

       430        440        450        460        470        480 
GGAPTGQGVS PSPSAILERR DVKPDEDLAG KAGGMVLVKG EGLYADPYGL LHEGRLSLAA 

       490        500        510        520        530        540 
AAETHSHTRA RAACTSGVPC ALSAPTPLPR CSPTWRTRCT RRALAALYGD GYGFRLPPSS 

       550        560        570        580        590        600 
PQKLADVSAP SGGPPPPHSP YSGPPSRGSP VRQSFRKDSG SSSVFAESPG GKARSTGSAS 

       610        620        630        640        650        660 
TAGAPPSELF PGPGERSLVG FGPPVPAKDT ETRERMEAME KQIASLTGLV QSALLRGSEP 

       670        680        690        700        710        720 
ETPSEKVEGS NGAATPSAPV CGSGSKSSGA TPVSGPPPPS ASSTPAGQPT AVSRLQMQLH 

       730        740        750        760        770        780 
LRGLQNSASD LRGQLQQLRN VQLQNQESVR ALLKPTEADV SMRVSEAARR QEDPLQRQRT 

       790        800        810        820        830        840 
LVEEERLRYL NDEELITQQL NDLEKSVEKI QRDVAHNHRL MPGPELEEKA LVLKQLGETL 

       850        860        870        880        890        900 
TELKAHFPGL QSKMRVVLRV EVEAVKFLKE EPQRLDGLLK RCRGVTDTLA QIRRQVDEGM 

       910        920        930        940        950        960 
WPPPNNLLNQ SPKKVAAETD FSKGLDFEIP PPSPPLNLHE LSGPAEGTPL TPKSTNPTKC 

       970        980        990       1000       1010       1020 
LDASSKRNTD KAVSVEAAER DWEEKRAALT QYSAKDINRL LEETQAELLK AIPDLDCASK 

      1030       1040       1050       1060       1070       1080 
THPGPAPTPD HKPPKAPHGQ KAAPRTEPSG RRGSDELTVP RYRTEKPSKS PPPPPPRRSF 

      1090       1100       1110       1120       1130       1140 
PSSHGLTTTR TGEVVVTSKK DSVFIKKAES EELEVQKPQV KLRRAVSEVV RPASTPPIMA 

      1150       1160       1170       1180       1190       1200 
SAIKDEDDEE RIIAELESGG SSVPPMKVVT PGASRLKAAQ GPAGSPDKGK HGKQRTEYMR 

      1210       1220       1230       1240       1250 
IQAQQQATKP SKEVSGPNET SSPGSEKPSG SRTSIPVLTS FGARNSSISF 

« Hide

Isoform 2 (1b) [UniParc].

Checksum: 67E3F46F8DB2BF60
Show »

FASTA1,216130,769
Isoform 3 [UniParc].

Checksum: 0C3CDFB50C28B195
Show »

FASTA1,206130,409

References

« Hide 'large scale' references
[1]Croci L., Bossolasco M., Consalez G.G.
Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[2]"Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 271-1250 (ISOFORM 3).
Tissue: Brain.
[3]"p130Cas-associated protein (p140Cap) as a new tyrosine-phosphorylated protein involved in cell spreading."
Di Stefano P., Cabodi S., Erba E.B., Margaria V., Bergatto E., Giuffrida M.G., Silengo L., Tarone G., Turco E., Defilippi P.
Mol. Biol. Cell 15:787-800(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
[4]"Phosphoproteomic analysis of the developing mouse brain."
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.
Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic brain.
[5]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411; SER-588; SER-1054 AND SER-1110, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[6]"Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain cortex.
[7]"Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-309 AND TYR-464, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[8]"Dynamic microtubules regulate dendritic spine morphology and synaptic plasticity."
Jaworski J., Kapitein L.C., Gouveia S.M., Dortland B.R., Wulf P.S., Grigoriev I., Camera P., Spangler S.A., Di Stefano P., Demmers J., Krugers H., Defilippi P., Akhmanova A., Hoogenraad C.C.
Neuron 61:85-100(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF040944 mRNA. Translation: AAC15635.1.
U59873 mRNA. Translation: AAD00087.1.
AK129422 mRNA. Translation: BAC98232.1. Frameshift.
PIRT34101.
RefSeqNP_061361.2. NM_018873.2.
UniGeneMm.342665.

3D structure databases

ProteinModelPortalQ9QWI6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid207768. 2 interactions.
IntActQ9QWI6. 21 interactions.
MINTMINT-4135063.

PTM databases

PhosphoSiteQ9QWI6.

Proteomic databases

MaxQBQ9QWI6.
PaxDbQ9QWI6.
PRIDEQ9QWI6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID56013.
KEGGmmu:56013.

Organism-specific databases

CTD80725.
MGIMGI:1933179. Srcin1.
RougeSearch...

Phylogenomic databases

eggNOGNOG69680.
HOGENOMHOG000293351.
HOVERGENHBG019587.
InParanoidQ9QWI6.
PhylomeDBQ9QWI6.

Gene expression databases

GenevestigatorQ9QWI6.

Family and domain databases

InterProIPR026727. Srcin1.
[Graphical view]
PANTHERPTHR22741:SF5. PTHR22741:SF5. 1 hit.
ProtoNetSearch...

Other

ChiTaRSSRCIN1. mouse.
NextBio311742.
PROQ9QWI6.
SOURCESearch...

Entry information

Entry nameSRCN1_MOUSE
AccessionPrimary (citable) accession number: Q9QWI6
Secondary accession number(s): O70298
Entry history
Integrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: January 16, 2004
Last modified: June 11, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot