Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SRC kinase signaling inhibitor 1

Gene

Srcin1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Exocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
SRC kinase signaling inhibitor 1
Alternative name(s):
SNAP-25-interacting protein
Short name:
SNIP
p130Cas-associated protein
p140Cap
Gene namesi
Name:Srcin1
Synonyms:Kiaa1684, P140
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1933179. Srcin1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000720121 – 1250SRC kinase signaling inhibitor 1Add BLAST1250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei47PhosphoserineCombined sources1
Modified residuei52PhosphoserineCombined sources1
Modified residuei79PhosphoserineCombined sources1
Modified residuei87PhosphoserineCombined sources1
Modified residuei98PhosphoserineCombined sources1
Modified residuei211PhosphoserineCombined sources1
Modified residuei233PhosphoserineBy similarity1
Modified residuei237PhosphoserineBy similarity1
Modified residuei247PhosphoserineCombined sources1
Modified residuei293PhosphoserineCombined sources1
Modified residuei309PhosphotyrosineCombined sources1
Modified residuei366PhosphoserineCombined sources1
Modified residuei375PhosphoserineCombined sources1
Modified residuei392PhosphoserineCombined sources1
Modified residuei397Omega-N-methylarginineCombined sources1
Modified residuei404Omega-N-methylarginineCombined sources1
Modified residuei411PhosphoserineCombined sources1
Modified residuei430PhosphoserineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei464PhosphotyrosineCombined sources1
Modified residuei559PhosphoserineCombined sources1
Modified residuei562PhosphoserineCombined sources1
Modified residuei566PhosphoserineCombined sources1
Modified residuei567Omega-N-methylarginineCombined sources1
Modified residuei569PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei581PhosphoserineCombined sources1
Modified residuei583PhosphoserineCombined sources1
Modified residuei588PhosphoserineCombined sources1
Modified residuei664PhosphoserineCombined sources1
Modified residuei688PhosphoserineCombined sources1
Modified residuei691PhosphothreonineCombined sources1
Modified residuei704PhosphothreonineCombined sources1
Modified residuei911PhosphoserineCombined sources1
Modified residuei933PhosphoserineCombined sources1
Modified residuei951PhosphothreonineBy similarity1
Modified residuei1054PhosphoserineCombined sources1
Modified residuei1110PhosphoserineCombined sources1
Modified residuei1127PhosphoserineCombined sources1

Post-translational modificationi

Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands.By similarity

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDbiQ9QWI6.
PeptideAtlasiQ9QWI6.
PRIDEiQ9QWI6.

PTM databases

iPTMnetiQ9QWI6.
PhosphoSitePlusiQ9QWI6.
SwissPalmiQ9QWI6.

Expressioni

Tissue specificityi

Expressed predominantly in central nervous system with high levels detected in cortex, cerebellum, midbrain and spinal cord (at protein level). Also expressed in testis and epithelial-rich tissues such as mammary gland, lung and kidney.2 Publications

Interactioni

Subunit structurei

Interacts with the N-terminal coiled-coil region of SNAP25. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
BCAR1P569453EBI-775592,EBI-702093From a different organism.
Bcar1Q611402EBI-775592,EBI-77088
CTTNQ142472EBI-775607,EBI-351886From a different organism.
MAPRE3Q9UPY85EBI-775607,EBI-726739From a different organism.
SORBS3O60504-24EBI-775607,EBI-1222956From a different organism.
SRCP005232EBI-775607,EBI-848039From a different organism.
SypP078252EBI-775607,EBI-976085From a different organism.

GO - Molecular functioni

Protein-protein interaction databases

BioGridi207768. 2 interactors.
IntActiQ9QWI6. 21 interactors.
MINTiMINT-4135063.
STRINGi10090.ENSMUSP00000103222.

Structurei

3D structure databases

ProteinModelPortaliQ9QWI6.
SMRiQ9QWI6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni681 – 731Interaction with SNAP25By similarityAdd BLAST51

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili627 – 654Sequence analysisAdd BLAST28
Coiled coili716 – 741Sequence analysisAdd BLAST26
Coiled coili783 – 845Sequence analysisAdd BLAST63

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1023 – 1081Pro-richAdd BLAST59

Sequence similaritiesi

Belongs to the SRCIN1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IHFG. Eukaryota.
ENOG410XTBA. LUCA.
HOGENOMiHOG000293351.
HOVERGENiHBG019587.
InParanoidiQ9QWI6.
KOiK19930.
PhylomeDBiQ9QWI6.

Family and domain databases

InterProiIPR022782. AIP3_C.
IPR026727. Srcin1.
[Graphical view]
PANTHERiPTHR22741:SF5. PTHR22741:SF5. 2 hits.
PfamiPF03915. AIP3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9QWI6-1) [UniParc]FASTAAdd to basket
Also known as: 1a1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQPWQCLRRF ALAWWERTAE GRARSPREEV GPRDPGGRGE PDPERSSPPM
60 70 80 90 100
LSADDAEYPR EYRTLGGGGG GGSGGRRFSN VGLVHTSERR HTVIAAQSLE
110 120 130 140 150
ALSGLQKADA DRKRDAFMDH LKSKYPQHAL ALRGQQDRMR EQVGGWTVDP
160 170 180 190 200
VCLLSSLCSH LHGDSTPSGA GQPAQQPNYW SFKTRSSRHT QGAQPGLADQ
210 220 230 240 250
AAKLSYASAE SLETMSEAEL PLGFSRMNRF RQSLPLSRSA SQTKLRSPGV
260 270 280 290 300
LFLQFGEETR RVHITHEVSS LDTLHALIAH MFPQKLTMGM LKSPNTAILI
310 320 330 340 350
KDEARNVFYE LEDVRDIQDR SIIKIYRKEP LYAAFPGSHL TNGDLRREMV
360 370 380 390 400
YASRESSPTR RLNNLSPASH LASSSPPPGL PSGLPSGLPS GSPSRSRLSY
410 420 430 440 450
AGGRPPSYAG SPVHHAAERL GGAPTGQGVS PSPSAILERR DVKPDEDLAG
460 470 480 490 500
KAGGMVLVKG EGLYADPYGL LHEGRLSLAA AAETHSHTRA RAACTSGVPC
510 520 530 540 550
ALSAPTPLPR CSPTWRTRCT RRALAALYGD GYGFRLPPSS PQKLADVSAP
560 570 580 590 600
SGGPPPPHSP YSGPPSRGSP VRQSFRKDSG SSSVFAESPG GKARSTGSAS
610 620 630 640 650
TAGAPPSELF PGPGERSLVG FGPPVPAKDT ETRERMEAME KQIASLTGLV
660 670 680 690 700
QSALLRGSEP ETPSEKVEGS NGAATPSAPV CGSGSKSSGA TPVSGPPPPS
710 720 730 740 750
ASSTPAGQPT AVSRLQMQLH LRGLQNSASD LRGQLQQLRN VQLQNQESVR
760 770 780 790 800
ALLKPTEADV SMRVSEAARR QEDPLQRQRT LVEEERLRYL NDEELITQQL
810 820 830 840 850
NDLEKSVEKI QRDVAHNHRL MPGPELEEKA LVLKQLGETL TELKAHFPGL
860 870 880 890 900
QSKMRVVLRV EVEAVKFLKE EPQRLDGLLK RCRGVTDTLA QIRRQVDEGM
910 920 930 940 950
WPPPNNLLNQ SPKKVAAETD FSKGLDFEIP PPSPPLNLHE LSGPAEGTPL
960 970 980 990 1000
TPKSTNPTKC LDASSKRNTD KAVSVEAAER DWEEKRAALT QYSAKDINRL
1010 1020 1030 1040 1050
LEETQAELLK AIPDLDCASK THPGPAPTPD HKPPKAPHGQ KAAPRTEPSG
1060 1070 1080 1090 1100
RRGSDELTVP RYRTEKPSKS PPPPPPRRSF PSSHGLTTTR TGEVVVTSKK
1110 1120 1130 1140 1150
DSVFIKKAES EELEVQKPQV KLRRAVSEVV RPASTPPIMA SAIKDEDDEE
1160 1170 1180 1190 1200
RIIAELESGG SSVPPMKVVT PGASRLKAAQ GPAGSPDKGK HGKQRTEYMR
1210 1220 1230 1240 1250
IQAQQQATKP SKEVSGPNET SSPGSEKPSG SRTSIPVLTS FGARNSSISF
Length:1,250
Mass (Da):134,859
Last modified:January 16, 2004 - v2
Checksum:i85F394C9523F78C0
GO
Isoform 21 Publication (identifier: Q9QWI6-2) [UniParc]FASTAAdd to basket
Also known as: 1b1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MQPWQCLRRFALAWWERTAEGRARSPREEVGPRDPGGRGEP → MGNAPSQ

Show »
Length:1,216
Mass (Da):130,769
Checksum:i67E3F46F8DB2BF60
GO
Isoform 3Curated (identifier: Q9QWI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1207-1250: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,206
Mass (Da):130,409
Checksum:i0C3CDFB50C28B195
GO

Sequence cautioni

The sequence BAC98232 differs from that shown. Reason: Frameshift at positions 483 and 527.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti740 – 741NV → KL in BAC98232 (PubMed:14621295).Curated2
Sequence conflicti755P → R in BAC98232 (PubMed:14621295).Curated1
Sequence conflicti759 – 760DV → EL in BAC98232 (PubMed:14621295).Curated2
Sequence conflicti821M → V in BAC98232 (PubMed:14621295).Curated1
Sequence conflicti960C → G in BAC98232 (PubMed:14621295).Curated1
Sequence conflicti1121 – 1122KL → NV in AAD00087 (Ref. 1) Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0506311 – 41MQPWQ…GRGEP → MGNAPSQ in isoform 2. 2 PublicationsAdd BLAST41
Alternative sequenceiVSP_0506321207 – 1250Missing in isoform 3. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040944 mRNA. Translation: AAC15635.1.
U59873 mRNA. Translation: AAD00087.1.
AK129422 mRNA. Translation: BAC98232.1. Frameshift.
PIRiT34101.
RefSeqiNP_061361.2. NM_018873.2.
UniGeneiMm.342665.

Genome annotation databases

GeneIDi56013.
KEGGimmu:56013.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040944 mRNA. Translation: AAC15635.1.
U59873 mRNA. Translation: AAD00087.1.
AK129422 mRNA. Translation: BAC98232.1. Frameshift.
PIRiT34101.
RefSeqiNP_061361.2. NM_018873.2.
UniGeneiMm.342665.

3D structure databases

ProteinModelPortaliQ9QWI6.
SMRiQ9QWI6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207768. 2 interactors.
IntActiQ9QWI6. 21 interactors.
MINTiMINT-4135063.
STRINGi10090.ENSMUSP00000103222.

PTM databases

iPTMnetiQ9QWI6.
PhosphoSitePlusiQ9QWI6.
SwissPalmiQ9QWI6.

Proteomic databases

PaxDbiQ9QWI6.
PeptideAtlasiQ9QWI6.
PRIDEiQ9QWI6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi56013.
KEGGimmu:56013.

Organism-specific databases

CTDi80725.
MGIiMGI:1933179. Srcin1.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IHFG. Eukaryota.
ENOG410XTBA. LUCA.
HOGENOMiHOG000293351.
HOVERGENiHBG019587.
InParanoidiQ9QWI6.
KOiK19930.
PhylomeDBiQ9QWI6.

Miscellaneous databases

ChiTaRSiSrcin1. mouse.
PROiQ9QWI6.
SOURCEiSearch...

Family and domain databases

InterProiIPR022782. AIP3_C.
IPR026727. Srcin1.
[Graphical view]
PANTHERiPTHR22741:SF5. PTHR22741:SF5. 2 hits.
PfamiPF03915. AIP3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRCN1_MOUSE
AccessioniPrimary (citable) accession number: Q9QWI6
Secondary accession number(s): O70298
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: January 16, 2004
Last modified: November 2, 2016
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.