Q9QWI6 (SRCN1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SRC kinase signaling inhibitor 1 Alternative name(s): SNAP-25-interacting protein Short name=SNIP p130Cas-associated protein p140Cap | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1250 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance By similarity. |
| Subunit structure | Interacts with the N-terminal coiled-coil region of SNAP25. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3 By similarity. |
| Subcellular location | Cytoplasm By similarity. Cytoplasm › cytoskeleton By similarity. Cell projection › axon By similarity. Cell projection › dendrite By similarity. Cell junction › synapse By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Note: Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions By similarity. |
| Tissue specificity | Expressed predominantly in central nervous system with high levels detected in cortex, cerebellum, midbrain and spinal cord (at protein level). Also expressed in testis and epithelial-rich tissues such as mammary gland, lung and kidney. Ref.3 Ref.10 |
| Post-translational modification | Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands By similarity. UniProtKB Q9C0H9 |
| Sequence similarities | Belongs to the SRCIN1 family. |
| Sequence caution | The sequence BAC98232.1 differs from that shown. Reason: Frameshift at positions 483 and 527. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCAR1 | P56945 | 3 | EBI-775592,EBI-702093 | From a different organism. |
| Bcar1 | Q61140 | 2 | EBI-775592,EBI-77088 | |
| CTTN | Q14247 | 2 | EBI-775607,EBI-351886 | From a different organism. |
| MAPRE3 | Q9UPY8 | 5 | EBI-775607,EBI-726739 | From a different organism. |
| SORBS3 | O60504-2 | 4 | EBI-775607,EBI-1222956 | From a different organism. |
| SRC | P00523 | 2 | EBI-775607,EBI-848039 | From a different organism. |
| Syp | P07825 | 2 | EBI-775607,EBI-976085 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.3 (identifier: Q9QWI6-1) Also known as: 1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.3 (identifier: Q9QWI6-2) Also known as: 1b; The sequence of this isoform differs from the canonical sequence as follows: 1-41: MQPWQCLRRFALAWWERTAEGRARSPREEVGPRDPGGRGEP → MGNAPSQ | ||||||
| Isoform 3 (identifier: Q9QWI6-3) The sequence of this isoform differs from the canonical sequence as follows: 1207-1250: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1250 | 1250 | SRC kinase signaling inhibitor 1 | PRO_0000072012 | |||||
Regions | |||||||||
| Region | 681 – 731 | 51 | Interaction with SNAP25 By similarity | ||||||
| Coiled coil | 627 – 654 | 28 | Potential | ||||||
| Coiled coil | 716 – 741 | 26 | Potential | ||||||
| Coiled coil | 783 – 845 | 63 | Potential | ||||||
| Compositional bias | 1023 – 1081 | 59 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 79 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 98 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 208 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 233 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 293 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 309 | 1 | Phosphotyrosine Ref.7 | ||||||
| Modified residue | 375 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 411 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 430 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 464 | 1 | Phosphotyrosine Ref.7 | ||||||
| Modified residue | 579 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 588 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 670 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 704 | 1 | Phosphothreonine Ref.8 | ||||||
| Modified residue | 933 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 974 | 1 | Phosphoserine | ||||||
| Modified residue | 1054 | 1 | Phosphoserine Ref.5 Ref.6 Ref.8 Ref.9 | ||||||
| Modified residue | 1110 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 41 | 41 | MQPWQ…GRGEP → MGNAPSQ in isoform 2. Ref.3 | VSP_050631 | |||||
| Alternative sequence | 1207 – 1250 | 44 | Missing in isoform 3. | VSP_050632 | |||||
Experimental info | |||||||||
| Sequence conflict | 740 – 741 | 2 | NV → KL in BAC98232. Ref.2 | ||||||
| Sequence conflict | 755 | 1 | P → R in BAC98232. Ref.2 | ||||||
| Sequence conflict | 759 – 760 | 2 | DV → EL in BAC98232. Ref.2 | ||||||
| Sequence conflict | 821 | 1 | M → V in BAC98232. Ref.2 | ||||||
| Sequence conflict | 960 | 1 | C → G in BAC98232. Ref.2 | ||||||
| Sequence conflict | 1121 – 1122 | 2 | KL → NV in AAD00087. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Croci L., Bossolasco M., Consalez G.G. Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H. DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 271-1250 (ISOFORM 3). Tissue: Brain. |
| [3] | "p130Cas-associated protein (p140Cap) as a new tyrosine-phosphorylated protein involved in cell spreading." Di Stefano P., Cabodi S., Erba E.B., Margaria V., Bergatto E., Giuffrida M.G., Silengo L., Tarone G., Turco E., Defilippi P. Mol. Biol. Cell 15:787-800(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY. |
| [4] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-208, MASS SPECTROMETRY. Tissue: Embryonic brain. |
| [5] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1054, MASS SPECTROMETRY. Tissue: Forebrain. |
| [6] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-233; SER-411; SER-588; SER-933; SER-1054 AND SER-1110, MASS SPECTROMETRY. Tissue: Brain. |
| [7] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-309 AND TYR-464, MASS SPECTROMETRY. Tissue: Brain. |
| [8] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-293; SER-375; SER-430; SER-579; SER-670; THR-704 AND SER-1054, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [9] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-79; SER-98 AND SER-1054, MASS SPECTROMETRY. Tissue: Melanoma. |
| [10] | "Dynamic microtubules regulate dendritic spine morphology and synaptic plasticity." Jaworski J., Kapitein L.C., Gouveia S.M., Dortland B.R., Wulf P.S., Grigoriev I., Camera P., Spangler S.A., Di Stefano P., Demmers J., Krugers H., Defilippi P., Akhmanova A., Hoogenraad C.C. Neuron 61:85-100(2009) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF040944 mRNA. Translation: AAC15635.1. U59873 mRNA. Translation: AAD00087.1. AK129422 mRNA. Translation: BAC98232.1. Frameshift. |
| IPI | IPI00396743. IPI00467346. IPI00828414. |
| PIR | T34101. |
| RefSeq | NP_061361.2. NM_018873.2. |
| UniGene | Mm.342665. |
3D structure databases | |
| ProteinModelPortal | Q9QWI6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9QWI6. 20 interactions. |
| MINT | MINT-4135063. |
PTM databases | |
| PhosphoSite | Q9QWI6. |
Proteomic databases | |
| PaxDb | Q9QWI6. |
| PRIDE | Q9QWI6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 56013. |
| KEGG | mmu:56013. |
Organism-specific databases | |
| CTD | 80725. |
| MGI | MGI:1933179. Srcin1. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG69680. |
| HOGENOM | HOG000293351. |
| HOVERGEN | HBG019587. |
| InParanoid | Q9QWI6. |
Gene expression databases | |
| Genevestigator | Q9QWI6. |
| GermOnline | ENSMUSG00000038453. Mus musculus. |
Family and domain databases | |
| InterPro | IPR026727. Srcin1. [Graphical view] |
| PANTHER | PTHR22741:SF5. PTHR22741:SF5. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SRCIN1. mouse. |
| NextBio | 311742. |
| SOURCE | Search... |
Entry information
| Entry name | SRCN1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QWI6 Secondary accession number(s): O70298 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
