SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QWI6

- SRCN1_MOUSE

UniProt

Q9QWI6 - SRCN1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

SRC kinase signaling inhibitor 1

Gene
Srcin1, Kiaa1684, P140
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of SRC by activating CSK which inhibits SRC activity and downstream signaling, leading to impaired cell spreading and migration. Regulates dendritic spine morphology. Involved in calcium-dependent exocytosis. May play a role in neurotransmitter release or synapse maintenance By similarity.

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. protein kinase binding Source: UniProtKB

GO - Biological processi

  1. exocytosis Source: UniProtKB-KW
  2. negative regulation of cell adhesion Source: MGI
  3. negative regulation of protein tyrosine kinase activity Source: UniProtKB
  4. positive regulation of protein tyrosine kinase activity Source: UniProtKB
  5. regulation of cell migration Source: UniProtKB
  6. regulation of dendritic spine morphogenesis Source: UniProtKB
  7. substrate adhesion-dependent cell spreading Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Exocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
SRC kinase signaling inhibitor 1
Alternative name(s):
SNAP-25-interacting protein
Short name:
SNIP
p130Cas-associated protein
p140Cap
Gene namesi
Name:Srcin1
Synonyms:Kiaa1684, P140
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:1933179. Srcin1.

Subcellular locationi

Cytoplasm By similarity. Cytoplasmcytoskeleton By similarity. Cell projectionaxon By similarity. Cell projectiondendrite By similarity. Cell junctionsynapse By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity
Note: Localized to the perinuclear region, lamellopodia, cortical actin and actin stress fibers but not to focal adhesions. Strongly expressed in axons and dendrites of the CA1 and CA3 hippocampal regions and of the dentate gyrus. Detected in both presynapses and postsynapses and in postsynaptic density fractions By similarity.

GO - Cellular componenti

  1. actin cytoskeleton Source: MGI
  2. axon Source: UniProtKB
  3. cell junction Source: UniProtKB-KW
  4. cytoplasm Source: UniProtKB
  5. dendrite Source: UniProtKB
  6. postsynaptic density Source: UniProtKB
  7. postsynaptic membrane Source: UniProtKB-KW
  8. synapse Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12501250SRC kinase signaling inhibitor 1PRO_0000072012Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei309 – 3091Phosphotyrosine1 Publication
Modified residuei411 – 4111Phosphoserine1 Publication
Modified residuei464 – 4641Phosphotyrosine1 Publication
Modified residuei588 – 5881Phosphoserine1 Publication
Modified residuei974 – 9741Phosphoserine
Modified residuei1054 – 10541Phosphoserine1 Publication
Modified residuei1110 – 11101Phosphoserine1 Publication

Post-translational modificationi

Tyrosine-phosphorylated in response to EGF and to cell adhesion to integrin ligands By similarity.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9QWI6.
PaxDbiQ9QWI6.
PRIDEiQ9QWI6.

PTM databases

PhosphoSiteiQ9QWI6.

Expressioni

Tissue specificityi

Expressed predominantly in central nervous system with high levels detected in cortex, cerebellum, midbrain and spinal cord (at protein level). Also expressed in testis and epithelial-rich tissues such as mammary gland, lung and kidney.2 Publications

Gene expression databases

GenevestigatoriQ9QWI6.

Interactioni

Subunit structurei

Interacts with the N-terminal coiled-coil region of SNAP25. Interacts with BCAR1/p130Cas and SRC through its C-terminal domain. Interacts with CSK, CTTN, SORBS3/vinexin, SYP and MAPRE3/EB3 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
BCAR1P569453EBI-775592,EBI-702093From a different organism.
Bcar1Q611402EBI-775592,EBI-77088
CTTNQ142472EBI-775607,EBI-351886From a different organism.
MAPRE3Q9UPY85EBI-775607,EBI-726739From a different organism.
SORBS3O60504-24EBI-775607,EBI-1222956From a different organism.
SRCP005232EBI-775607,EBI-848039From a different organism.
SypP078252EBI-775607,EBI-976085From a different organism.

Protein-protein interaction databases

BioGridi207768. 2 interactions.
IntActiQ9QWI6. 21 interactions.
MINTiMINT-4135063.

Structurei

3D structure databases

ProteinModelPortaliQ9QWI6.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni681 – 73151Interaction with SNAP25 By similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili627 – 65428 Reviewed predictionAdd
BLAST
Coiled coili716 – 74126 Reviewed predictionAdd
BLAST
Coiled coili783 – 84563 Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1023 – 108159Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the SRCIN1 family.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG69680.
HOGENOMiHOG000293351.
HOVERGENiHBG019587.
InParanoidiQ9QWI6.
PhylomeDBiQ9QWI6.

Family and domain databases

InterProiIPR026727. Srcin1.
[Graphical view]
PANTHERiPTHR22741:SF5. PTHR22741:SF5. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q9QWI6-1) [UniParc]FASTAAdd to Basket

Also known as: 1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQPWQCLRRF ALAWWERTAE GRARSPREEV GPRDPGGRGE PDPERSSPPM     50
LSADDAEYPR EYRTLGGGGG GGSGGRRFSN VGLVHTSERR HTVIAAQSLE 100
ALSGLQKADA DRKRDAFMDH LKSKYPQHAL ALRGQQDRMR EQVGGWTVDP 150
VCLLSSLCSH LHGDSTPSGA GQPAQQPNYW SFKTRSSRHT QGAQPGLADQ 200
AAKLSYASAE SLETMSEAEL PLGFSRMNRF RQSLPLSRSA SQTKLRSPGV 250
LFLQFGEETR RVHITHEVSS LDTLHALIAH MFPQKLTMGM LKSPNTAILI 300
KDEARNVFYE LEDVRDIQDR SIIKIYRKEP LYAAFPGSHL TNGDLRREMV 350
YASRESSPTR RLNNLSPASH LASSSPPPGL PSGLPSGLPS GSPSRSRLSY 400
AGGRPPSYAG SPVHHAAERL GGAPTGQGVS PSPSAILERR DVKPDEDLAG 450
KAGGMVLVKG EGLYADPYGL LHEGRLSLAA AAETHSHTRA RAACTSGVPC 500
ALSAPTPLPR CSPTWRTRCT RRALAALYGD GYGFRLPPSS PQKLADVSAP 550
SGGPPPPHSP YSGPPSRGSP VRQSFRKDSG SSSVFAESPG GKARSTGSAS 600
TAGAPPSELF PGPGERSLVG FGPPVPAKDT ETRERMEAME KQIASLTGLV 650
QSALLRGSEP ETPSEKVEGS NGAATPSAPV CGSGSKSSGA TPVSGPPPPS 700
ASSTPAGQPT AVSRLQMQLH LRGLQNSASD LRGQLQQLRN VQLQNQESVR 750
ALLKPTEADV SMRVSEAARR QEDPLQRQRT LVEEERLRYL NDEELITQQL 800
NDLEKSVEKI QRDVAHNHRL MPGPELEEKA LVLKQLGETL TELKAHFPGL 850
QSKMRVVLRV EVEAVKFLKE EPQRLDGLLK RCRGVTDTLA QIRRQVDEGM 900
WPPPNNLLNQ SPKKVAAETD FSKGLDFEIP PPSPPLNLHE LSGPAEGTPL 950
TPKSTNPTKC LDASSKRNTD KAVSVEAAER DWEEKRAALT QYSAKDINRL 1000
LEETQAELLK AIPDLDCASK THPGPAPTPD HKPPKAPHGQ KAAPRTEPSG 1050
RRGSDELTVP RYRTEKPSKS PPPPPPRRSF PSSHGLTTTR TGEVVVTSKK 1100
DSVFIKKAES EELEVQKPQV KLRRAVSEVV RPASTPPIMA SAIKDEDDEE 1150
RIIAELESGG SSVPPMKVVT PGASRLKAAQ GPAGSPDKGK HGKQRTEYMR 1200
IQAQQQATKP SKEVSGPNET SSPGSEKPSG SRTSIPVLTS FGARNSSISF 1250
Length:1,250
Mass (Da):134,859
Last modified:January 16, 2004 - v2
Checksum:i85F394C9523F78C0
GO
Isoform 21 Publication (identifier: Q9QWI6-2) [UniParc]FASTAAdd to Basket

Also known as: 1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MQPWQCLRRFALAWWERTAEGRARSPREEVGPRDPGGRGEP → MGNAPSQ

Show »
Length:1,216
Mass (Da):130,769
Checksum:i67E3F46F8DB2BF60
GO
Isoform 3 (identifier: Q9QWI6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1207-1250: Missing.

Note: No experimental confirmation available.

Show »
Length:1,206
Mass (Da):130,409
Checksum:i0C3CDFB50C28B195
GO

Sequence cautioni

The sequence BAC98232.1 differs from that shown. Reason: Frameshift at positions 483 and 527.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4141MQPWQ…GRGEP → MGNAPSQ in isoform 2. 1 PublicationVSP_050631Add
BLAST
Alternative sequencei1207 – 125044Missing in isoform 3. VSP_050632Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti740 – 7412NV → KL in BAC98232. 1 Publication
Sequence conflicti755 – 7551P → R in BAC98232. 1 Publication
Sequence conflicti759 – 7602DV → EL in BAC98232. 1 Publication
Sequence conflicti821 – 8211M → V in BAC98232. 1 Publication
Sequence conflicti960 – 9601C → G in BAC98232. 1 Publication
Sequence conflicti1121 – 11222KL → NV in AAD00087. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF040944 mRNA. Translation: AAC15635.1.
U59873 mRNA. Translation: AAD00087.1.
AK129422 mRNA. Translation: BAC98232.1. Frameshift.
PIRiT34101.
RefSeqiNP_061361.2. NM_018873.2.
UniGeneiMm.342665.

Genome annotation databases

GeneIDi56013.
KEGGimmu:56013.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF040944 mRNA. Translation: AAC15635.1 .
U59873 mRNA. Translation: AAD00087.1 .
AK129422 mRNA. Translation: BAC98232.1 . Frameshift.
PIRi T34101.
RefSeqi NP_061361.2. NM_018873.2.
UniGenei Mm.342665.

3D structure databases

ProteinModelPortali Q9QWI6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 207768. 2 interactions.
IntActi Q9QWI6. 21 interactions.
MINTi MINT-4135063.

PTM databases

PhosphoSitei Q9QWI6.

Proteomic databases

MaxQBi Q9QWI6.
PaxDbi Q9QWI6.
PRIDEi Q9QWI6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 56013.
KEGGi mmu:56013.

Organism-specific databases

CTDi 80725.
MGIi MGI:1933179. Srcin1.
Rougei Search...

Phylogenomic databases

eggNOGi NOG69680.
HOGENOMi HOG000293351.
HOVERGENi HBG019587.
InParanoidi Q9QWI6.
PhylomeDBi Q9QWI6.

Miscellaneous databases

ChiTaRSi SRCIN1. mouse.
NextBioi 311742.
PROi Q9QWI6.
SOURCEi Search...

Gene expression databases

Genevestigatori Q9QWI6.

Family and domain databases

InterProi IPR026727. Srcin1.
[Graphical view ]
PANTHERi PTHR22741:SF5. PTHR22741:SF5. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Croci L., Bossolasco M., Consalez G.G.
    Submitted (DEC-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 271-1250 (ISOFORM 3).
    Tissue: Brain.
  3. "p130Cas-associated protein (p140Cap) as a new tyrosine-phosphorylated protein involved in cell spreading."
    Di Stefano P., Cabodi S., Erba E.B., Margaria V., Bergatto E., Giuffrida M.G., Silengo L., Tarone G., Turco E., Defilippi P.
    Mol. Biol. Cell 15:787-800(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  5. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-411; SER-588; SER-1054 AND SER-1110, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  6. "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations."
    Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M.
    Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain cortex.
  7. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
    Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
    J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-309 AND TYR-464, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  8. Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiSRCN1_MOUSE
AccessioniPrimary (citable) accession number: Q9QWI6
Secondary accession number(s): O70298
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 16, 2004
Last sequence update: January 16, 2004
Last modified: June 11, 2014
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi